PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa05g085860.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 180aa MW: 19497.2 Da PI: 10.0016 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 137 | 2.2e-42 | 14 | 155 | 4 | 163 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvss 98 s++e++ yv+C+ Cntilav +P + ++ +vtv+CGhC +l ++ + + + h + l + +++ + k+ s+s+s ss Csa05g085860.1 14 SSQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFLTTSP-----PLQGH--------VS--LTLQMQSFGGSEYKKGSSSSSSSS 93 5789************************************975533222.....22232........32..333445566666666666655555 PP YABBY 99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ++++ p +p v++PPek+qr Psaynrf+++eiqrik++nP+i hreafsaaaknWa + Csa05g085860.1 94 T---SSDQPPPPTPPFVVKPPEKKQRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKY 155 2...234444555555***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.5E-49 | 16 | 155 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.17E-8 | 99 | 154 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 6.9E-5 | 109 | 154 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MNLEEKPTMT SKASSQAEHL YYVRCSICNT ILAVGIPLKR MLDTVTVKCG HCGNLSFLTT 60 SPPLQGHVSL TLQMQSFGGS EYKKGSSSSS SSSTSSDQPP PPTPPFVVKP PEKKQRLPSA 120 YNRFMRDEIQ RIKSANPEIP HREAFSAAAK NWAKYIPNSP TSITSGGNNI HGLAFGEKK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa05g085860.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ119055 | 0.0 | DQ119055.1 Brassica juncea transcription factor CRC mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010511942.1 | 1e-131 | PREDICTED: protein CRABS CLAW | ||||
Swissprot | Q8L925 | 1e-108 | CRC_ARATH; Protein CRABS CLAW | ||||
TrEMBL | Q45R44 | 1e-118 | Q45R44_BRAJU; Transcription factor CRC | ||||
TrEMBL | R0HWC6 | 1e-118 | R0HWC6_9BRAS; Uncharacterized protein | ||||
STRING | XP_010511942.1 | 1e-131 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9725 | 28 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 1e-110 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|