PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa05g085860.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

YABBY

Protein Properties

Length: 180aa MW: 19497.2 Da PI: 10.0016

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa05g085860.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	137	2.2e-42	14	155	4	163
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvss 98 s++e++ yv+C+ Cntilav +P + ++ +vtv+CGhC +l ++ + + + h + l + +++ + k+ s+s+s ss Csa05g085860.1 14 SSQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFLTTSP-----PLQGH--------VS--LTLQMQSFGGSEYKKGSSSSSSSS 93 5789**********************************975533222.....22232........32..333445566666666666655555 PP YABBY 99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ++++ p +p v++PPek+qr Psaynrf+++eiqrik++nP+i hreafsaaaknWa + Csa05g085860.1 94 T---SSDQPPPPTPPFVVKPPEKKQRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKY 155 2...234444555555*********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.5E-49	16	155	IPR006780	YABBY protein
SuperFamily	SSF47095	1.17E-8	99	154	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	6.9E-5	109	154	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MNLEEKPTMT SKASSQAEHL YYVRCSICNT ILAVGIPLKR MLDTVTVKCG HCGNLSFLTT 60 SPPLQGHVSL TLQMQSFGGS EYKKGSSSSS SSSTSSDQPP PPTPPFVVKP PEKKQRLPSA 120 YNRFMRDEIQ RIKSANPEIP HREAFSAAAK NWAKYIPNSP TSITSGGNNI HGLAFGEKK*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa05g085860.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ119055	0.0	DQ119055.1 Brassica juncea transcription factor CRC mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010511942.1	1e-131	PREDICTED: protein CRABS CLAW
Swissprot	Q8L925	1e-108	CRC_ARATH; Protein CRABS CLAW
TrEMBL	Q45R44	1e-118	Q45R44_BRAJU; Transcription factor CRC
TrEMBL	R0HWC6	1e-118	R0HWC6_9BRAS; Uncharacterized protein
STRING	XP_010511942.1	1e-131	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9725	28	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	1e-110	YABBY family protein

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]