PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa05g085440.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

Protein Properties

Length: 124aa MW: 14273.4 Da PI: 11.0197

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa05g085440.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	65.8	6.4e-21	2	57	38	93
EEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS B3 38 ledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 + + +g++W+++++y+++s++yvltkGW++Fvk+++L++gD+v+F+++ +++l+ Csa05g085440.1 2 VSNVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFQRSTGLDRQLY 57 67889*****************************************7655555455 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	13.394	1	66	IPR003340	B3 DNA binding domain
Pfam	PF02362	6.1E-18	2	60	IPR003340	B3 DNA binding domain
SuperFamily	SSF101936	7.85E-18	3	58	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	5.6E-22	4	64	IPR015300	DNA-binding pseudobarrel domain
CDD	cd10017	3.26E-15	4	49	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 124 aa Download sequence Send to blast
MVSNVNGKVW RFRYSYWNSS QSYVLTKGWS RFVKEKNLRA GDVVTFQRST GLDRQLYIDW 60 KIRSGPRENP VQVVVRLFGV DIFNVNTVKP NDVVAVCGRK RSRDADDMFG LRCSRKQAII 120 NPL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wid_A	4e-33	4	65	58	119	DNA-binding protein RAV1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269\|PubMed:18718758, ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa05g085440.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB013887	1e-142	AB013887.1 Arabidopsis thaliana mRNA for RAV2, complete cds.
GenBank	AC011665	1e-142	AC011665.8 Arabidopsis thaliana chromosome 1 BAC T6L1 genomic sequence, complete sequence.
GenBank	AC011914	1e-142	AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBank	AF003101	1e-142	AF003101.1 Arabidopsis thaliana AP2 domain containing protein RAP2.8 mRNA, partial cds.
GenBank	AF360312	1e-142	AF360312.1 Arabidopsis thaliana putative DNA-binding protein(RAV2 (At1g68840) mRNA, complete cds.
GenBank	AY056361	1e-142	AY056361.1 Arabidopsis thaliana putative DNA-binding protein RAV2 (At1g68840) mRNA, complete cds.
GenBank	CP002684	1e-142	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019083256.1	8e-78	PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2
Swissprot	P82280	2e-76	RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBL	R0IF20	3e-75	R0IF20_9BRAS; Uncharacterized protein
STRING	XP_010415512.1	3e-77	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM848	27	121

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G68840.2	6e-79	related to ABI3/VP1 2

Publications ? help Back to Top
Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S RAV genes: regulation of floral induction and beyond. Ann. Bot., 2014. 114(7): p. 1459-70 [PMID:24812253] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Sun YW, et al. Attenuation of Histone Methyltransferase KRYPTONITE-mediated transcriptional gene silencing by Geminivirus. Sci Rep, 2015. 5: p. 16476 [PMID:26602265] Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering. Plant Sci., 2015. 241: p. 78-95 [PMID:26706061] Matías-Hernández L, et al. TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation. Plant Physiol., 2016. 170(3): p. 1624-39 [PMID:26802039] Li P, et al. The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895]