PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa05g001360.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 154aa MW: 17281.5 Da PI: 7.1279 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171 | 1.4e-53 | 42 | 137 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+ +lk+yl+++r +ege Csa05g001360.1 42 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAGQLKKYLHRFRVIEGE 136 89*******************************************************************************************99 PP NF-YB 97 k 97 k Csa05g001360.1 137 K 137 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.4E-52 | 35 | 147 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.06E-39 | 44 | 150 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.3E-28 | 47 | 111 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.1E-17 | 75 | 93 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 78 | 94 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.1E-17 | 94 | 112 | No hit | No description |
PRINTS | PR00615 | 2.1E-17 | 113 | 131 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MAGDNPWFKN PIQNYNFGSS SSHDRHGLVV EDQQEENMMM IKEQDRLLPI ANVGRIMKNI 60 LPPNAKISKE AKETMQECVS EFISFVTGEA SDKCHKEKRK TVNGDDICWA MANLGFDDYA 120 GQLKKYLHRF RVIEGEKANH HGKGGPSKSS PDN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa05g001360.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC005309 | 1e-141 | AC005309.3 Arabidopsis thaliana chromosome 2 clone F17A22 map CIC06C03, complete sequence. | |||
GenBank | BT003968 | 1e-141 | BT003968.1 Arabidopsis thaliana clone RAFL15-27-K05 (R20859) putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
GenBank | BT005081 | 1e-141 | BT005081.1 Arabidopsis thaliana clone U20859 putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
GenBank | CP002685 | 1e-141 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010507851.1 | 1e-113 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 4e-91 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | V4LI05 | 5e-89 | V4LI05_EUTSA; Uncharacterized protein | ||||
STRING | XP_010507851.1 | 1e-112 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-93 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|