PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa05952s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 113aa MW: 12582.4 Da PI: 6.9365 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 54.8 | 1.9e-17 | 39 | 77 | 2 | 40 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk Csa05952s010.1 39 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 77 689**********************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 4.2E-19 | 38 | 79 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 19.901 | 39 | 113 | IPR005172 | CRC domain |
Pfam | PF03638 | 4.4E-13 | 41 | 76 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
NETREDADQD VPVEPALQEL NLSSPKKKRV KLDSGEGDSC KRCNCKKSKC LKLYCECFAA 60 GVYCIEPCSC IDCFNKPIHE DTVLATRKQI ESRNPLAFAP KVIRNSDSVL ETG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 24 | 31 | PKKKRVKL |
2 | 24 | 32 | PKKKRVKLD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa05952s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL161539 | 3e-65 | AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39. | |||
GenBank | CP002687 | 3e-65 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
GenBank | Z97337 | 3e-65 | Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010440393.1 | 5e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 | ||||
Refseq | XP_019089594.1 | 1e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1 | ||||
Refseq | XP_019089595.1 | 1e-74 | PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2 | ||||
Swissprot | F4JIF5 | 2e-71 | TCX2_ARATH; Protein tesmin/TSO1-like CXC 2 | ||||
TrEMBL | A0A178UVP4 | 5e-69 | A0A178UVP4_ARATH; TCX2 | ||||
TrEMBL | A0A1P8B4Y7 | 4e-69 | A0A1P8B4Y7_ARATH; TESMIN/TSO1-like CXC 2 | ||||
TrEMBL | A0A1P8B4Z6 | 4e-69 | A0A1P8B4Z6_ARATH; TESMIN/TSO1-like CXC 2 | ||||
TrEMBL | R0F1B1 | 5e-69 | R0F1B1_9BRAS; Uncharacterized protein | ||||
STRING | XP_010440393.1 | 2e-73 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15196 | 10 | 15 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14770.1 | 1e-55 | TESMIN/TSO1-like CXC 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|