PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g065610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 610aa    MW: 67966.9 Da    PI: 6.6551
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g065610.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.32.9e-23127227198
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++
  Csa04g065610.1 127 FVKILTASDTSTHGGFSVLRKHATEClpsldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGETG 219
                     89****************************9666677789************************************************..34899 PP

                     ..EEEEE- CS
              B3  91 elvvkvfr 98 
                      l+v+v+r
  Csa04g065610.1 220 DLRVGVRR 227
                     99***998 PP

2Auxin_resp96.93e-32253332183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++tks+F v+Y+Pr   s+F+++v+k++ a+k+ +++GmRf+m+fe+e+s+er ++Gt++g  dl++ +Wp SkWrsL+
  Csa04g065610.1 253 ASHAVNTKSIFIVLYKPRI--SQFIISVNKYMVAMKNGFALGMRFRMRFEGEESPERIFTGTIIGSGDLSS-QWPASKWRSLQ 332
                     789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-39112256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-38120242IPR015300DNA-binding pseudobarrel domain
CDDcd100175.41E-20126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
PfamPF023622.4E-21127227IPR003340B3 DNA binding domain
SMARTSM010192.3E-21127229IPR003340B3 DNA binding domain
PfamPF065074.9E-29253332IPR010525Auxin response factor
PfamPF023096.1E-9471534IPR033389AUX/IAA domain
SuperFamilySSF542777.85E-14494574No hitNo description
PROSITE profilePS5174526.984498590IPR000270PB1 domain
PfamPF023091.5E-6544583IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MANVVVDADF RRSGSNEDDQ LYTELWKACA GPLVEVPRYG ERVFYFPQGH MEQLVASTNQ  60
GVVDQEIPVF DLPPKILCRV LSVVLKAEHE TDEVYAQITL HPEEDQSEPT SLDPPVVEPA  120
KPKVDSFVKI LTASDTSTHG GFSVLRKHAT ECLPSLDMTQ PTPTQELVAR DLHGYEWRFK  180
HIFRGQPRRH LLTTGWSTFV TSKRLVAGDA FVFLRGETGD LRVGVRRLAR QQSTMPASVI  240
SSQSMRLGVL ATASHAVNTK SIFIVLYKPR ISQFIISVNK YMVAMKNGFA LGMRFRMRFE  300
GEESPERIFT GTIIGSGDLS SQWPASKWRS LQIQWDEASS IQRPNKVSSW EIEPFSPPTL  360
TSTPTQPQSK SKRSRPIDSS ISEITGSPVA STYLSSFSQS HESNPSVKLL FHDPATERNL  420
NKSVFSSGLK GKTTEAPVTS CCRLFGFDLT SKPSSSAPVP PEKQIISVNS NNSDSTTKCQ  480
DPNSSNSTKE QKQQTSTRSR TKVQMQGTAV GRAVDLTLLR SYDELIKELE KMFEIEGELS  540
PKDKWAVVFT DDEGDMMLVG DDPWDEFCKM AKKLFIYSSD EVKKMSSKSL LDDEGTIVNL  600
ESDQRTVHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1611235610356Auxin response factor 1
4ldw_A1e-1611235610356Auxin response factor 1
4ldw_B1e-1611235610356Auxin response factor 1
4ldx_A1e-1611235610356Auxin response factor 1
4ldx_B1e-1611235610356Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa04g065610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299240.0AK229924.1 Arabidopsis thaliana mRNA for ARF1 family auxin responsive transcription factor like protein, complete cds, clone: RAFL22-28-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506661.10.0PREDICTED: auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLR0HBF00.0R0HBF0_9BRAS; Auxin response factor
STRINGXP_010506661.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]