PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa04g022670.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 102aa MW: 11357.7 Da PI: 4.2566 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 71.7 | 1.2e-22 | 47 | 101 | 1 | 55 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsf 55 s+yk+kaal v+ ++p+f+aldsg++ l+++G+lll++a+++++r+ydW kkq+f Csa04g022670.1 47 SIYKGKAALIVDLRAPEFVALDSGAFNLSKDGFLLLQFAPSAGVRQYDWTKKQVF 101 7****************************************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 2.1E-23 | 36 | 101 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 6.51E-19 | 41 | 101 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 3.9E-19 | 48 | 101 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MLEVQELMVD NQSDDDDIHE PREETQCQID ASWDAKGSPA RFYVGNSIYK GKAALIVDLR 60 APEFVALDSG AFNLSKDGFL LLQFAPSAGV RQYDWTKKQV F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4koo_A | 1e-36 | 35 | 101 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_B | 1e-36 | 35 | 101 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_C | 1e-36 | 35 | 101 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_D | 1e-36 | 35 | 101 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa04g022670.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF332452 | 7e-66 | AF332452.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
GenBank | AF370156 | 7e-66 | AF370156.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
GenBank | AY059097 | 7e-66 | AY059097.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010480475.1 | 1e-36 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Swissprot | Q9M9S3 | 1e-35 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | R0GJR8 | 9e-34 | R0GJR8_9BRAS; Uncharacterized protein | ||||
STRING | XP_010480475.1 | 5e-36 | (Camelina sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 4e-38 | ssDNA-binding transcriptional regulator |