PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g038550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 612aa    MW: 69088.5 Da    PI: 7.2593
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g038550.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.71.2e-24126227199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g l++pk+ a+e+      +++   +++   +d++g++W++k+++r+k++r+++t+GW+ Fv  ++L +gD++vF   + ++
  Csa03g038550.1 126 FKKILTASDTSSHGGLSIPKRDATECfplldmSLP-VPTQEFLTKDLHGNEWRFKHSFRGKPRRHLITTGWSAFVTTKKLVAGDVLVFV--RGEN 217
                     89****************************97444.44458999*********************************************..3488 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+++r+
  Csa03g038550.1 218 EELRVGIRRA 227
                     899****996 PP

2Auxin_resp100.71.9e-33252331183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+++k++F+vvY+Pr+  s+F+v+++++++a+++k+svG+Rf m+fe++d s+rr+sGt++gv++++p +W++S+WrsL+
  Csa03g038550.1 252 AVHAFHSKCMFSVVYKPRS--SQFIVSYDNFLDAMNKKFSVGSRFTMQFEGDDLSKRRYSGTIIGVNNFSP-HWKDSEWRSLQ 331
                     799***************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-38115239IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-31120249IPR015300DNA-binding pseudobarrel domain
CDDcd100171.72E-24125226No hitNo description
PfamPF023622.6E-22126227IPR003340B3 DNA binding domain
PROSITE profilePS5086313.324126228IPR003340B3 DNA binding domain
SMARTSM010194.2E-24126228IPR003340B3 DNA binding domain
PfamPF065072.0E-29252331IPR010525Auxin response factor
PfamPF023094.9E-6505552IPR033389AUX/IAA domain
PROSITE profilePS5174525.41516597IPR000270PB1 domain
SuperFamilySSF542771.62E-11518592No hitNo description
PfamPF023091.7E-5562602IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MESGNVVNEQ PELSGIVDET KSYLYEQLWN LCAGPLCDLP KLGEKVYYFP QGHIEFVEAS  60
TREELNQIQP NFDIPSKLQC HVIAIHRKVE INTDQVYAEI TLMPDTTQVI IPTQNDSNDM  120
PKINFFKKIL TASDTSSHGG LSIPKRDATE CFPLLDMSLP VPTQEFLTKD LHGNEWRFKH  180
SFRGKPRRHL ITTGWSAFVT TKKLVAGDVL VFVRGENEEL RVGIRRAGHQ KGNTPSSLVS  240
TESMRHGVIV SAVHAFHSKC MFSVVYKPRS SQFIVSYDNF LDAMNKKFSV GSRFTMQFEG  300
DDLSKRRYSG TIIGVNNFSP HWKDSEWRSL QVRWDEFVSF PRPNRVSPWE IEHLTPSSNV  360
IQLSLLKNKR SRHVNEIGSS SSHRLPPILI EVQEIGQPSM TSPMSIPQLG NRDAIEDSKN  420
PSNRLMSYSV PSMPNRYYNN DQMITPIKEN ITINAGGSCR LFGVTLTTPS EIKDHVEPND  480
NQISGTSKLS QERKLGLTQT SKSPTEIQSK QFSSIRSCTK VQMQGVAIGR ALDLNVLNGY  540
DQLIHELDKL FDLKGKLQTC NQWEIVFTDD EGDMMLAGDD PWPEFCNIVK KIFILSKEEV  600
KNLKSGTNVS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1262435419355Auxin response factor 1
4ldw_A1e-1262435419355Auxin response factor 1
4ldw_B1e-1262435419355Auxin response factor 1
4ldx_A1e-1252435419355Auxin response factor 1
4ldx_B1e-1252435419355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa03g038550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGXP_010499991.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14