PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g038320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 331aa    MW: 37302.5 Da    PI: 8.5774
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g038320.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.64.7e-1823922899
                    --..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 28 gkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    +++  +++l+l+d++ ++W++k+++r++++r+++t+GW+ Fv +++L +gD +++   +r+++el+v+++r+
  Csa03g038320.1 23 SQPVPTQELVLKDLHDNQWKFKHTFRGTPQRHLFTTGWNAFVTSKKLVAGDHFIIL--RRENGELLVGIRRA 92
                    44445669*******************************************99999..679*********97 PP

2Auxin_resp95.86.7e-32117196183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     +++a++t+++F vvY+Pr+  s+Fvv+++k+e+alk+k+  G+Rf m+fe+e +se+r+sG+v+gv+dl+p +W+nS+WrsL+
  Csa03g038320.1 117 VVNAFNTNCMFIVVYKPRS--SQFVVRYNKFEDALKNKFNFGSRFMMRFEGEKFSEKRYSGIVIGVKDLSP-HWKNSEWRSLQ 196
                     68999*************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.323193IPR003340B3 DNA binding domain
SMARTSM010198.1E-8793IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.5E-2318106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-181893IPR015300DNA-binding pseudobarrel domain
PfamPF023628.1E-152592IPR003340B3 DNA binding domain
CDDcd100172.87E-132591No hitNo description
PfamPF065071.4E-27118196IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MPDTNEVVIP ITNDSSRKPK DMSQPVPTQE LVLKDLHDNQ WKFKHTFRGT PQRHLFTTGW  60
NAFVTSKKLV AGDHFIILRR ENGELLVGIR RAKYEIDHIP SSVISAQCML HGVIASVVNA  120
FNTNCMFIVV YKPRSSQFVV RYNKFEDALK NKFNFGSRFM MRFEGEKFSE KRYSGIVIGV  180
KDLSPHWKNS EWRSLQVQWD EVSPFPKPNN VSAWEIEPLV PSSNNFQSTL LQKKSPCQTG  240
SSSSIVLTDN KIGQPNMSSP ENAPQLCDHD VVDDSKVSYG SLMSYRVPTM PNPNCANDQI  300
VQPVQENITT DATTSCMLFG VDLLATPSKK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A2e-7114219147355Auxin response factor 1
4ldw_A2e-7114219147355Auxin response factor 1
4ldw_B2e-7114219147355Auxin response factor 1
4ldx_A2e-7114219147355Auxin response factor 1
4ldx_B2e-7114219147355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa03g038320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019095946.10.0PREDICTED: auxin response factor 13-like
SwissprotQ9FX251e-127ARFM_ARATH; Auxin response factor 13
TrEMBLD7KJF31e-133D7KJF3_ARALL; Auxin response factor
STRINGXP_010501775.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34170.11e-131AUXIN RESPONSE FACTOR 13