PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa03g012250.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

MYB_related

Protein Properties

Length: 182aa MW: 20773.5 Da PI: 9.9151

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa03g012250.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.7	1.5e-14	43	88	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l Csa03g012250.1 43 RGNFTSHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 88 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.17E-20	24	98	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.5E-9	24	48	IPR009057	Homeodomain-like
PROSITE profile	PS50090	4.135	24	37	IPR017877	Myb-like domain
PROSITE profile	PS51294	22.681	38	92	IPR017930	Myb domain
SMART	SM00717	2.6E-12	42	90	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-12	43	88	IPR001005	SANT/Myb domain
CDD	cd00167	1.74E-8	45	88	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.5E-20	49	93	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 182 aa Download sequence Send to blast
MALETGDVFP PTLVIIFLIT WLLRCSKSCR LRWTNYLRPG IKRGNFTSHE EGMIIHLQAL 60 LGNKWASIAS YLPQRTDNDI KNYWNTHLKK KLNKSECDAE RSRSSENITL QTSASRNTIN 120 HRSTYASSTE NISRLLEGWM RASPKSSAAN HQTNSLIDHQ NHQSPYEQLQ GSWEQVKMLT 180 A*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-17	24	93	40	109	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa03g012250.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117469	1e-145	AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBank	AY519551	1e-145	AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBank	BT005074	1e-145	BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
GenBank	DQ767951	1e-145	DQ767951.1 Arabidopsis thaliana putative transcription factor (MYB60) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010489412.1	1e-109	PREDICTED: myb-related protein 306-like
Swissprot	Q8GYP5	3e-89	MYB60_ARATH; Transcription factor MYB60
TrEMBL	R0GRH1	2e-94	R0GRH1_9BRAS; Uncharacterized protein
STRING	XP_010489412.1	1e-108	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	1e-91	myb domain protein 60

Publications ? help Back to Top
Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339]