PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g062190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CO-like
Protein Properties Length: 673aa    MW: 73406.6 Da    PI: 5.2721
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g062190.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.41.3e-071958340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                    +r C+ +++  +  fC+ +  +lC +C + +H+   H++v
  Csa02g062190.1 19 ARSCDACKSVTAAVFCRVDTAFLCITCDTRIHSFtrHERV 58
                    578******99*********************65778865 PP

2zf-B_box26.99.8e-0958103342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  Csa02g062190.1  58 VWVCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplasrHERVPV 103
                     689*****************************66999999999986 PP

3zf-B_box23.41.3e-07314353340
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40 
                     +r C+ +++  +  fC+ +  +lC +C + +H+   H++v
  Csa02g062190.1 314 ARSCDACKSVTAAVFCRVDTAFLCITCDTRIHSFtrHERV 353
                     578******99*********************65778865 PP

4zf-B_box26.99.8e-09353398342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  Csa02g062190.1 353 VWVCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplasrHERVPV 398
                     689*****************************66999999999986 PP

5CCT68.81.4e-23603646144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Csa02g062190.1 603 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 646
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.941760IPR000315B-box-type zinc finger
SMARTSM003361.6E-61760IPR000315B-box-type zinc finger
CDDcd000212.57E-72060No hitNo description
PfamPF006439.0E-62058IPR000315B-box-type zinc finger
PROSITE profilePS5011910.72256103IPR000315B-box-type zinc finger
PfamPF006431.0E-657103IPR000315B-box-type zinc finger
CDDcd000217.21E-859103No hitNo description
SMARTSM003364.6E-1061103IPR000315B-box-type zinc finger
PROSITE profilePS501199.94312355IPR000315B-box-type zinc finger
SMARTSM003361.6E-6312355IPR000315B-box-type zinc finger
CDDcd000212.57E-7315355No hitNo description
PfamPF006439.0E-6315353IPR000315B-box-type zinc finger
PROSITE profilePS5011910.722351398IPR000315B-box-type zinc finger
PfamPF006431.0E-6352398IPR000315B-box-type zinc finger
CDDcd000217.21E-8354398No hitNo description
SMARTSM003364.6E-10356398IPR000315B-box-type zinc finger
PfamPF062031.3E-17603645IPR010402CCT domain
PROSITE profilePS5101716.817603645IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MGFSLESIKS ISGGWGAAAR SCDACKSVTA AVFCRVDTAF LCITCDTRIH SFTRHERVWV  60
CEVCEQAPAA VTCKADAAAL CVTCDSDIHS ANPLASRHER VPVESFFDSA VAKISPSSTF  120
GILGSSTTVD LTGSVPVMND DLGLCPWLLP NDFNEPAKIE IGTENMKGSD FMFSDFDRLI  180
DFEFPNSLSH HHHQQPSGGD SLVPVQTKTE PLPLTNINDH CFDIDFCRSK LSSFTYPTQS  240
LSYGVVPADQ SSLLSTSSLE YGVVPDGNNT NNNSVSEIXT FSSFQFSQTS KKEREKQRDL  300
ESIKSISGGW GAAARSCDAC KSVTAAVFCR VDTAFLCITC DTRIHSFTRH ERVWVCEVCE  360
QAPAAVTCKA DAAALCVTCD SDIHSANPLA SRHERVPVES FFDSAVAKIS PSSTFGILGS  420
STTVDLTGSV PVMNDDLGLC PWLLPNDFNE PAKIEIGTEN MKGSDFMFSD FDRLIDFEFP  480
NSLSHHHHQQ PSGGDSLVPV QTKTEPLPLT NINDHCFDID FCRSKLSSFT YPTQSLSYGV  540
VPADQSSLLS TSSLEYGVVP DGNNTNNNSV SEISIPFNRS TITTSSTAAT TTTGGDQTSS  600
MDREARVLRY REKRKNRKFE KTIRYASRKA YAESRPRIKG RFAKRTETEN DDVFFSHVYA  660
SAAAQYGVVP TF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa02g062190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0884320.0AY088432.1 Arabidopsis thaliana clone 6639 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010452640.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X1
RefseqXP_019092606.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X2
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLR0EWL40.0R0EWL4_9BRAS; Uncharacterized protein
STRINGXP_010452640.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]