PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa02g044810.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 6949.13 Da PI: 10.7083 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.5 | 4.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++s Csa02g044810.1 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFAS 59 78***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.244 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-28 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.42E-35 | 3 | 60 | No hit | No description |
PRINTS | PR00404 | 5.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFASS 60 E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa02g044810.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025623 | 5e-78 | AB025623.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJM18. | |||
GenBank | CP002688 | 5e-78 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001078745.1 | 1e-35 | K-box region and MADS-box transcription factor family protein | ||||
Swissprot | Q9FLH5 | 1e-36 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A178UL76 | 2e-34 | A0A178UL76_ARATH; AGL72 | ||||
STRING | AT5G51860.1 | 6e-35 | (Arabidopsis thaliana) | ||||
STRING | scaffold_801621.1 | 5e-35 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 4e-39 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|