PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa02g039190.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 141aa MW: 15156 Da PI: 4.2681 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 76.6 | 3.5e-24 | 21 | 84 | 37 | 100 |
NF-YC 37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100 +++ aea v++ska e+fi++lt+r+w+ha+enk +t++ diaaav rt++ dfl+d+v +e Csa02g039190.1 21 NKMEAEAAVVFSKASEMFIMDLTMRAWNHAHENKHTTIRGPDIAAAVGRTFTMDFLLDVVHVEE 84 6789*******************************************************98775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 7.04E-15 | 20 | 82 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.4E-16 | 22 | 80 | IPR009072 | Histone-fold |
Pfam | PF00125 | 5.4E-7 | 23 | 67 | IPR007125 | Histone H2A/H2B/H3 |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MENKSNQLPQ DNPKLKSYWL NKMEAEAAVV FSKASEMFIM DLTMRAWNHA HENKHTTIRG 60 PDIAAAVGRT FTMDFLLDVV HVEEEPDHED GELPPGMVIG TPVVDGSGIF GDVLEPWPGT 120 WTVAPVGEDV PGGSGGNGGN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 3e-18 | 23 | 80 | 36 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa02g039190.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010472782.1 | 2e-99 | PREDICTED: nuclear transcription factor Y subunit C-8-like | ||||
Swissprot | Q4PSE2 | 3e-30 | NFYC8_ARATH; Nuclear transcription factor Y subunit C-8 | ||||
TrEMBL | R0HYD5 | 9e-46 | R0HYD5_9BRAS; Uncharacterized protein | ||||
STRING | XP_010472782.1 | 7e-99 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17675 | 5 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G27910.1 | 5e-19 | nuclear factor Y, subunit C8 |
Publications ? help Back to Top | |||
---|---|---|---|
|