PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 250aa    MW: 27680.7 Da    PI: 9.7057
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570454.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-393089362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    e++lkcprC+stntkfCyynny+lsqPr+fCk+CrryWt+GGalrnvPvGgg+r++kk++
  XP_012570454.1 30 ETTLKCPRCESTNTKFCYYNNYNLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRSKKTK 89
                    6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-253084IPR003851Zinc finger, Dof-type
PfamPF027015.5E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.7023387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MIRPSSIANS NQAQVQTQTQ AQQPKIQPQE TTLKCPRCES TNTKFCYYNN YNLSQPRHFC  60
KTCRRYWTRG GALRNVPVGG GCRRSKKTKK STTTNTTSSK TPLLSNSNEK DYSLSNSTSL  120
GEFLHPTNNR TYLTPLGVGN IGQMGFQIGD YSSNIAVGEG GGGLDQWRFQ QFPFLNGFES  180
NSNVSYPFQS EIVEPPTTSR VTHMPSSVKL ENINGGLNLL RSSLSISENN NHYNSWPDFS  240
SLASSSASHL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012570454.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1488962e-71BT148896.1 Medicago truncatula clone JCVI-FLMt-20F11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027187820.10.0dof zinc finger protein DOF3.6-like isoform X2
SwissprotQ9M2U12e-39DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A3Q7YCX60.0A0A3Q7YCX6_CICAR; dof zinc finger protein DOF3.6-like isoform X2
STRINGXP_004487016.10.0(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-33OBF-binding protein 3