PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_012569580.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 207aa MW: 23574.6 Da PI: 8.9886 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.6 | 1e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd++l+ ++ +G g+W++ ++ g+ R++k+c++rw +yl XP_012569580.1 14 KGPWSDEEDQILISHIQTYGHGNWRALPKQAGLLRCGKSCRLRWKNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.6 | 1.2e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE++ ++++++ lG++ W+tIa++++ gRt++++k++w+++l XP_012569580.1 67 RGKFSDEEEDSIIKLHEILGNK-WSTIAARLP-GRTDNEVKNFWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.0E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.422 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.19E-30 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.47E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.127 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.5E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.6E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.09E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MTKTPCCERM GMRKGPWSDE EDQILISHIQ TYGHGNWRAL PKQAGLLRCG KSCRLRWKNY 60 LRPDIKRGKF SDEEEDSIIK LHEILGNKWS TIAARLPGRT DNEVKNFWHT HLKKRVQKNK 120 VQNANTSYSY NTLLDAQASD VSSVGEKSVI SKYCLASTKE PNIVSPGFYN AISCDTLGEN 180 VGNHSSSQIS EEMEFWYNVF IKSAQPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-28 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_012569580.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012569580.1 | 1e-156 | transcription factor MYB4-like | ||||
Swissprot | Q7XBH4 | 1e-69 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A0A1S3E1G5 | 1e-155 | A0A1S3E1G5_CICAR; transcription factor MYB4-like | ||||
STRING | XP_007147213.1 | 5e-99 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-69 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|