PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_012568098.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 89aa MW: 9764.84 Da PI: 7.7578 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 101.8 | 4.7e-32 | 19 | 76 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++v+Y eC+kNhAa++Gg+avDGC+Efm+s geegt+ al CaACgCHRnFH+reve+e XP_012568098.1 19 RSVKYGECQKNHAANVGGYAVDGCREFMAS-GEEGTSVALICAACGCHRNFHKREVENE 76 5799*************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 5.0E-22 | 1 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 3.3E-30 | 21 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 4.7E-26 | 22 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.626 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MRKRQVVVRR TSSCEDQQRS VKYGECQKNH AANVGGYAVD GCREFMASGE EGTSVALICA 60 ACGCHRNFHK REVENEVVSE CSSPHSNGT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_012568098.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027187539.1 | 1e-59 | mini zinc finger protein 2-like | ||||
Refseq | XP_027187540.1 | 1e-59 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 3e-37 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A1S3DY23 | 3e-58 | A0A1S3DY23_CICAR; mini zinc finger protein 2-like | ||||
STRING | XP_004489393.1 | 4e-59 | (Cicer arietinum) | ||||
STRING | XP_004489394.1 | 4e-59 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-31 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|