PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004513720.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 241aa MW: 27878.4 Da PI: 9.481 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.4 | 6e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++g+lyey+ XP_004513720.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSTRGRLYEYA 74 79***********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.796 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.9E-41 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.1E-32 | 18 | 93 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.39E-43 | 18 | 91 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-26 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.9E-25 | 100 | 187 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.522 | 103 | 193 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MELPNHEDGE GSSQKKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LVVFSTRGRL YEYANNSVRA TIERYKKACS ATTNAESVSE ANTQFYQQES SKLRRQIRDI 120 QNLNRHILGE ALGSLSLKEL KNLEGRLEKG LSRVRSRKHE TLFADVEFMQ KREIDLQNQN 180 NYLRAKIAEC ERAQQQQQNM MPETYSESLP SQSYDRNFFP VNLLGSDQQY SRQDQTALQL 240 V |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004513720.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX297566 | 0.0 | JX297566.1 Medicago monspeliaca voucher PI 641560 shatterproof mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004513719.1 | 1e-178 | agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_004513720.1 | 1e-178 | agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_004513721.1 | 1e-178 | agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_027186051.1 | 1e-178 | agamous-like MADS-box protein AGL1 isoform X2 | ||||
Swissprot | Q93XH4 | 1e-125 | MADS1_VITVI; Agamous-like MADS-box protein MADS1 | ||||
TrEMBL | A0A1S2Z298 | 1e-177 | A0A1S2Z298_CICAR; agamous-like MADS-box protein AGL1 isoform X1 | ||||
STRING | XP_004513719.1 | 1e-178 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 1e-120 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|