PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004505012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 304aa    MW: 34157.3 Da    PI: 8.5493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004505012.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.96.8e-3648107261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +e+ lkcprC+stntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr++++ +
  XP_004505012.1  48 TEQVLKCPRCESTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKRVK 107
                     67899***********************************************97766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-204996IPR003851Zinc finger, Dof-type
PfamPF027017.3E-3250104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.33552106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGLSSKQVSS SGLDNWKQNL LESQDLELPK PHHMMRKHHQ QQQQQQQTEQ VLKCPRCEST  60
NTKFCYYNNY NKSQPRHFCR ACKRHWTKGG TLRNVPVGGG RKNKRVKKSN TPITSSTTKT  120
TTTATNAICT PSISNMNGNG LNSNMTIQTP LGISDQKSNN IPSSLYQALI HPPSLFLQQS  180
LMNTRDLLES KDFGIGNGIF TSTSCSTYPI LPQNQSLLFP FSTSSSFDTT TCPSSNVYYY  240
GEEFKTMEEP TINSIVPSTK PWEMSLPGTT TAGMETSKYW NWEDIDSLVS TDLKDPWDDS  300
DIKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004505012.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505012.10.0dof zinc finger protein DOF1.4-like
TrEMBLA0A1S2YHT20.0A0A1S2YHT2_CICAR; dof zinc finger protein DOF1.4-like
STRINGXP_004505012.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.13e-24Dof family protein