PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004504028.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 20958.3 Da PI: 5.8565 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.4 | 7.4e-57 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plkvyl++yre+ege XP_004504028.1 28 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVYLNNYREIEGE 122 89********************************************************************************************9 PP NF-YB 97 k 97 k XP_004504028.1 123 K 123 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-53 | 23 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.97E-41 | 30 | 136 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.9E-27 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-18 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-18 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 1.4E-18 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MTGNKRINQT SPVGSPTSGN ISDSSSSKEQ DRFLPIANVS RIMKRALPAN AKISKEAKET 60 VQECVSEFIS FITGEASDKC QREKRKTING DDLLWAMTTL GFENYVGPLK VYLNNYREIE 120 GEKSNSMVKQ DDSSIEVVND GVIGGFYSQQ VNTNGSSKRF HEIGGGGDVE TEHGSGNRII 180 PPNLCYRVEW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004504028.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC202494 | 1e-150 | AC202494.23 Medicago truncatula clone mth2-25j15, complete sequence. | |||
GenBank | JQ918280 | 1e-150 | JQ918280.1 Medicago truncatula nuclear transcription factor Y subunit B7 (NF-YB7) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004504028.1 | 1e-140 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O23310 | 1e-63 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A1S2YFG1 | 1e-138 | A0A1S2YFG1_CICAR; nuclear transcription factor Y subunit B-1-like | ||||
STRING | XP_004504028.1 | 1e-139 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-66 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|