PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004498386.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 137aa MW: 15240.2 Da PI: 7.6288 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 118.6 | 2.9e-37 | 24 | 112 | 7 | 95 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +P++ ++rim++++Pa+akis+ ake++q cvsefi+ +t+eas++c+ e+rk ++++dl+wa+ +lGfedy pl yl +yr+ e+ XP_004498386.1 24 RMPVTHLTRIMQRAIPAQAKISNGAKESMQFCVSEFITIITTEASERCKFEHRKIVTAEDLIWAMDKLGFEDYTGPLVFYLDNYRKNEA 112 69***********************************************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.2E-34 | 13 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.63E-29 | 22 | 113 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.6E-18 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.0E-8 | 52 | 70 | No hit | No description |
PRINTS | PR00615 | 2.0E-8 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 2.0E-8 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MEHGSPSSNH SRKAQSSSGS EKLRMPVTHL TRIMQRAIPA QAKISNGAKE SMQFCVSEFI 60 TIITTEASER CKFEHRKIVT AEDLIWAMDK LGFEDYTGPL VFYLDNYRKN EAQFTAMAIA 120 HGLNKDASNS GSGNDQP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-33 | 25 | 109 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004498386.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004498386.1 | 1e-101 | nuclear transcription factor Y subunit B-3-like | ||||
TrEMBL | A0A1S2Y2L3 | 1e-99 | A0A1S2Y2L3_CICAR; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_004498386.1 | 1e-100 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21178 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-35 | nuclear factor Y, subunit B3 |