PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004495979.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 16490.5 Da PI: 5.1409 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 166.3 | 4e-52 | 37 | 131 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdr+lPianv+rimk++lP nakisk+aket+qecvsef+sfvt+easdkc++ekrkt+ngdd++ a++tlGf+dy+eplk yl+k+rel+ + XP_004495979.1 37 REQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTVNGDDVCSAFSTLGFDDYAEPLKRYLNKFRELDVQ 131 89*****************************************************************************************9866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-51 | 31 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.93E-38 | 39 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.6E-26 | 42 | 105 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.5E-19 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 7.5E-19 | 89 | 107 | No hit | No description |
PRINTS | PR00615 | 7.5E-19 | 108 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MSEKKKGKLP DRESFYKYNN NFMREEEEED DDENIIREQD RLLPIANVGR IMKQILPPNA 60 KISKEAKETM QECVSEFVSF VTGEASDKCH KEKRKTVNGD DVCSAFSTLG FDDYAEPLKR 120 YLNKFRELDV QRSNQNKGGN IN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-44 | 36 | 127 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-44 | 36 | 127 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004495979.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004495979.1 | 1e-101 | nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 8e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1S2XXA9 | 1e-100 | A0A1S2XXA9_CICAR; nuclear transcription factor Y subunit B-5 | ||||
STRING | XP_004495979.1 | 1e-101 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-57 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|