PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004492130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 385aa    MW: 41819.2 Da    PI: 9.4565
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004492130.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-3877135462
          zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+s+
  XP_004492130.1  77 AAQKCPRCESTNTKFCYYNNYNLSQPRHFCKTCRRYWTRGGTLRNVPVGGGCRRNKRSK 135
                     6789****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2957128IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3278133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MVFPSLPIYL DPTNWSQRQA RIEIGTQNSL PLQLPPASTV ASTVTAEAGG SYQGFIRPGS  60
MADRARMSKI HQNEVAAAQK CPRCESTNTK FCYYNNYNLS QPRHFCKTCR RYWTRGGTLR  120
NVPVGGGCRR NKRSKVNSIS KSSTSKPNHD HRSVGTGVVA GVGGSSSTGA NASSNNGCID  180
SNVNVGMAHF QTQFPFLSSL NHFNNNDYVS GGIGSLMAKN ISNSTTTSVE FQLGNGSSLG  240
NSNVGSLFLS NGIGEQWRFS NPEQVHHHPH QQQQQQQRNQ QFPFLTNLEP QIGLFQFGSG  300
ENNEPPTSFI HSKAIDSSSV GIGTIPQVNN IKMEENNHQV LSLPKNLLSG SGNSNDIFWN  360
GNGNSNANAW NNEVPSFTPS PSQLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128135RRNKRSKV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004492130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004492130.10.0dof zinc finger protein DOF3.6-like
TrEMBLA0A1S2XPX80.0A0A1S2XPX8_CICAR; dof zinc finger protein DOF3.6-like
STRINGXP_004492130.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-35DNA binding with one finger 2.4