PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491816.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 493aa    MW: 54400 Da    PI: 6.1351
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491816.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-39126186262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  XP_004491816.1 126 PDKILPCPRCSSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSS 186
                     7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-31123183IPR003851Zinc finger, Dof-type
PfamPF027014.9E-32128184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.807130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MSETKDPAIK LFGKTIPVPD ILVGTPALSS GDVVDESIDQ NHDSSINSSK DEQEQEIVMD  60
TLGDKPTDGK KEDGVPTKSS EEFSTPDAAS RTGEESEREA ATLKTSKIEE EQDETSNSHD  120
KNLKKPDKIL PCPRCSSMDT KFCYYNNYNV NQPRHFCKNC QRYWTAGGTM RNVPVGAGRR  180
KNKNSSSHYR QITVTESTLQ NSRTDFPRRS YQPSLKCNGT LLTFGSETPL CESVASVLKL  240
ADRTVQNYAR NGFDKPEELR ICVPHATGEK GDDQSNKSSI TSTKSMEGGR TNVSQEQAMS  300
NGQSFPLQGH YFRPGTPWPF PWNPMQWSSP VPPPSLCQPG FSLPLYPATT YWGCTVPGAW  360
NIPWQAQPLS PNGANLNSSP NSPTLGKHSR EDNSIRSSDS SGTDGDGKKE SSEEKCLWFP  420
KTLRIDDSRE AEKSSFWTTL GIKNDNTNSV PSRGLFEAFP SKCDDKNHSV QASLVLQANP  480
AALSRSLNFQ ETS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004491816.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491816.10.0cyclic dof factor 2
TrEMBLA0A1S2XQ510.0A0A1S2XQ51_CICAR; cyclic dof factor 2
STRINGXP_004491816.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-97cycling DOF factor 2