PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 376aa    MW: 42127.4 Da    PI: 8.4673
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.52.6e-37117176261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+++cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG +rn+PvG+grrknk s
  XP_004490083.1 117 PDKIQPCPRCSSNDTKFCYYNNYNVKQPRHFCKNCQRYWTAGGIMRNMPVGAGRRKNKIS 176
                     78999****************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-28110174IPR003851Zinc finger, Dof-type
PfamPF027012.2E-30119174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.689121175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610123159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MKLFGRTISL TCNTDVSTND SSSFPREDFS HHSPYSSSSS PLEMNSSTEH QTKRHKEPSR  60
KELTSDDEAS QQTTEDSKSH TSSCLIENPR TPSSETETSQ QNGEKSDMSQ DKSLTKPDKI  120
QPCPRCSSND TKFCYYNNYN VKQPRHFCKN CQRYWTAGGI MRNMPVGAGR RKNKISHFSS  180
ADSNYRQVIP QSTAVLTFGS DSNMSSTLHE EKVNKCYQNF PPQFPFQNHP WNPSMIPHAA  240
FYQQSYPVSF YPNIAYYGGF LPQSWSVQSI STQSCEPNSP TSGKHSRDGE ILFHSNSKKE  300
KLGSESNNNS NSVLIPKTLR IDEPDEAAKS SSTWSKLGIK AFASKGGDKN HVVETSSILQ  360
ANPAALSRSL VFHERI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004490083.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490083.10.0cyclic dof factor 3-like
SwissprotQ93ZL55e-58CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A1S2XJ130.0A0A1S2XJ13_CICAR; cyclic dof factor 3-like
STRINGXP_004490083.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1731037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-60cycling DOF factor 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]