PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489646.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 351aa    MW: 39339.9 Da    PI: 8.5854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489646.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82e-3799158261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+++cprC+s +tkfCy+nny+++qPr+fC++C+ryWt+GG++r vPvG+grrknk+ 
  XP_004489646.1  99 PDKIVQCPRCNSFDTKFCYFNNYNVNQPRHFCRNCHRYWTAGGTMRSVPVGSGRRKNKHI 158
                     7899******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2787156IPR003851Zinc finger, Dof-type
PfamPF027013.5E-31101157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.801103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MNCETNNNMF VKDSSIMLFG KKIPVPEYHI PATSQKGCQI QANSTPMNSC SNTKHTGVEI  60
FHTENYEKSK TSSKVNNSIP LEEKKETSNT DQEKVLKKPD KIVQCPRCNS FDTKFCYFNN  120
YNVNQPRHFC RNCHRYWTAG GTMRSVPVGS GRRKNKHIAS QYRHIIATSN GNPIERLDIE  180
NTSRYQNVST DKSIVLKFGQ FGHDTSFREE EESSLCVSSI SNGYTRGNEL SESEYNRSNS  240
LQSYPASQWM VPLNQSWNNA SSIAQSSMQW CHAPMVAVKN ILTPNIPLQF VHGSYWHGNG  300
TVSISSNGCI SPSSTSSNSC CSGNGSPILE KKPDTRVFVP TTLRISDTNL E
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004489646.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489646.10.0cyclic dof factor 1-like
TrEMBLA0A1S2XJN90.0A0A1S2XJN9_CICAR; cyclic dof factor 1-like
STRINGXP_004489646.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.18e-39Dof family protein