PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004485893.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 150aa MW: 16930.2 Da PI: 8.723 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 125.2 | 2e-39 | 38 | 97 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 +e++++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt GGalrnvP+G+grrk k + XP_004485893.1 38 PEEIIPCPRCKSMETKFCYFNNYNVNQPRHFCKTCQRYWTSGGALRNVPIGAGRRKPKPT 97 78999***************************************************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-27 | 37 | 95 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.8E-32 | 40 | 95 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.043 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 44 | 80 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MGEENQGIKL FGAIIKLHDE ELKEGEKGSE DLTVEKKPEE IIPCPRCKSM ETKFCYFNNY 60 NVNQPRHFCK TCQRYWTSGG ALRNVPIGAG RRKPKPTDGA LYETNSGDGH DKFGLVLDKW 120 QVDTAESNFR QVLSGKRRRT TSGGYSLALL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004485893.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004485893.1 | 1e-110 | cyclic dof factor 4 | ||||
Swissprot | O22967 | 2e-47 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A1S2XCM1 | 1e-109 | A0A1S2XCM1_CICAR; cyclic dof factor 4 | ||||
STRING | XP_004485893.1 | 1e-109 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 7e-50 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|