PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g21800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 471aa    MW: 52563.4 Da    PI: 6.5729
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g21800genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS468.34.2e-143494671374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lLl+cA +v+sg+le+a+  L ++s+lasp+gd+mqR+a+yf eALa r++rs+++l+kal++++ s   +see+ ++k+f+e++P+lk++++++N
  CA12g21800  49 LIHLLLACASHVASGSLENANISLDHISQLASPSGDTMQRIASYFNEALADRILRSWPGLFKALRSTKLS--VVSEEILVRKMFFEIFPFLKVAFVVTN 145
                 689*************************************************************999998..6************************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn  v+++le+l++e+Lrvk+
  CA12g21800 146 QAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTQEAEKLDIPFQFNQ-VVSTLESLDVEKLRVKT 239
                 **************************************************....9**************************.79*************** PP

        GRAS 199 gEalaVnlvlqlhrll......................................................desvsles..erdevLklvkslsPkvvvv 241
                 gEala+++++qlh+ll                                                       ++       + d++L+++++lsPkv+vv
  CA12g21800 240 GEALAISSIMQLHTLLahdnekksplplkhkngvtlpralinqntfgeflekdmangcspsndtasssplCST----GssKMDSFLNALWGLSPKVMVV 334
                 *************************************************************999875443333....2346799*************** PP

        GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                 +eq+++hn+++++er++e+l++y+alfd+le++lpr+s erikvE++llg+ei+++vaceg er+erhe+lekW +r+++aGF++vpls++a+ qa++l
  CA12g21800 335 TEQDSNHNATTLMERLSESLHFYAALFDCLESTLPRTSLERIKVEKMLLGEEIKSIVACEGIERKERHEKLEKWFQRFDTAGFGNVPLSYYAMLQARRL 433
                 *************************************************************************************************** PP

        GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 l+ ++ +gy+++e +g++v++W+dr+L+svS+Wr
  CA12g21800 434 LQSYSCEGYKIKEVNGCVVICWQDRALFSVSSWR 467
                 *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.70523447IPR005202Transcription factor GRAS
PfamPF035141.5E-14049467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLQVFP VMSLSPGLGF GSSNQWLKEL KSEERGLYLI HLLLACASHV  60
ASGSLENANI SLDHISQLAS PSGDTMQRIA SYFNEALADR ILRSWPGLFK ALRSTKLSVV  120
SEEILVRKMF FEIFPFLKVA FVVTNQAIIE AMEGEKMVHI VDLNAAEPLQ WRALLQDLSA  180
RPEGPPHLRI TGVHQQKEVL DQMAHVLTQE AEKLDIPFQF NQVVSTLESL DVEKLRVKTG  240
EALAISSIMQ LHTLLAHDNE KKSPLPLKHK NGVTLPRALI NQNTFGEFLE KDMANGCSPS  300
NDTASSSPLC STGSSKMDSF LNALWGLSPK VMVVTEQDSN HNATTLMERL SESLHFYAAL  360
FDCLESTLPR TSLERIKVEK MLLGEEIKSI VACEGIERKE RHEKLEKWFQ RFDTAGFGNV  420
PLSYYAMLQA RRLLQSYSCE GYKIKEVNGC VVICWQDRAL FSVSSWRCRK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-38314691381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552026.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2G2YB400.0A0A2G2YB40_CAPAN; Scarecrow-like protein 3
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]