PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g21100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 280aa    MW: 32949.6 Da    PI: 7.6596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g21100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +lv++++ +G g+W+t a++ g++Rt+k+c++rw++yl
       CA12g21100 14 RGPWTVEEDFILVNYIAHHGEGRWNTLAHCAGLKRTGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.52.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       CA12g21100  67 RGNITLEEQLLILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 110
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.852961IPR017930Myb domain
SuperFamilySSF466894.79E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-151363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-221568IPR009057Homeodomain-like
CDDcd001678.12E-111661No hitNo description
PROSITE profilePS5129423.2262116IPR017930Myb domain
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002494.5E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2369115IPR009057Homeodomain-like
CDDcd001671.24E-687110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDKIRENNIV ELKRGPWTVE EDFILVNYIA HHGEGRWNTL AHCAGLKRTG KSCRLRWLNY  60
LRPDVRRGNI TLEEQLLILQ LHSRWGNRWS KIAQHLPGRT DNEIKNYWRT RVQKHAKQLK  120
CDVNSKQFKD TLHYLWIPRL VERIKASTNS NNNQVNNIQQ TNYDNIIINN NNNNNNNIVQ  180
NVMNNFKQEN YSSTTTTSSE NSFGSTQISD MSDNCYTNYP LNQGDYHGEI LINPTSDYFQ  240
HGIIDDNNHQ QNMSQLFFDD VSDKFWNQED MLFLQQQLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261110824120MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-122HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552281.11e-148PREDICTED: transcription factor MYB108-like
TrEMBLA0A1U8F0V31e-147A0A1U8F0V3_CAPAN; Transcription factor
TrEMBLA0A2G2YBQ11e-147A0A2G2YBQ1_CAPAN; transcription factor MYB108-like
STRINGPGSC0003DMT4000117481e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-78myb domain protein 108