PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g07260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 214aa    MW: 24321 Da    PI: 5.6381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g07260genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.6e-091862345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      WT  Ed+++ +a  ++  +   +W +Ia++++ gRt +++  ++ 
       CA12g07260 18 TWTRFEDKQFEQALVLYSENdveRWQKIANHVP-GRTVEDVMMHYD 62
                     7********************************.*******99985 PP

2Myb_DNA-binding44.44e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       CA12g07260 122 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 166
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.56E-121165IPR009057Homeodomain-like
PROSITE profilePS512937.9481468IPR017884SANT domain
SMARTSM007171.6E-81567IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-61765IPR009057Homeodomain-like
CDDcd001676.17E-91865No hitNo description
PfamPF002491.8E-71862IPR001005SANT/Myb domain
PROSITE profilePS5129421.268115171IPR017930Myb domain
SuperFamilySSF466894.0E-17117172IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-17118170IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11119165IPR009057Homeodomain-like
SMARTSM007177.3E-11119169IPR001005SANT/Myb domain
CDDcd001671.09E-9122166No hitNo description
PfamPF002494.4E-12122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MIGDAANNST DMIQSNSTWT RFEDKQFEQA LVLYSENDVE RWQKIANHVP GRTVEDVMMH  60
YDTLVHDVFE IDSGRVEPPS YPDDDGGFGG DWDELDGGKL SQISFGGGAS KKQEVERKKG  120
TPWTEEEHRL FLIGLDKYGK GDWRSISRNV VVTRTPTQVA SHAQKYYLRQ QSMKKERKRS  180
SIHDITTAVD TKMVPPQNSL QNQGAYQNFN FPM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0128561e-130BT012856.1 Lycopersicon esculentum clone 113942F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551180.11e-159PREDICTED: transcription factor DIVARICATA-like isoform X1
SwissprotQ9FNN66e-61SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2G2Y6R51e-158A0A2G2Y6R5_CAPAN; Transcription factor DIVARICATA
TrEMBLA0A2G3AV261e-158A0A2G3AV26_CAPCH; Transcription factor DIVARICATA
STRINGXP_009796939.11e-122(Nicotiana sylvestris)
STRINGXP_009618932.11e-122(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-71MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]