PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA12g07260 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 214aa MW: 24321 Da PI: 5.6381 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29 | 2.6e-09 | 18 | 62 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 WT Ed+++ +a ++ + +W +Ia++++ gRt +++ ++ CA12g07260 18 TWTRFEDKQFEQALVLYSENdveRWQKIANHVP-GRTVEDVMMHYD 62 7********************************.*******99985 PP | |||||||
2 | Myb_DNA-binding | 44.4 | 4e-14 | 122 | 166 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky CA12g07260 122 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 166 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.56E-12 | 11 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 7.948 | 14 | 68 | IPR017884 | SANT domain |
SMART | SM00717 | 1.6E-8 | 15 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-6 | 17 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.17E-9 | 18 | 65 | No hit | No description |
Pfam | PF00249 | 1.8E-7 | 18 | 62 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.268 | 115 | 171 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.0E-17 | 117 | 172 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.3E-17 | 118 | 170 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.3E-11 | 119 | 165 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.3E-11 | 119 | 169 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.09E-9 | 122 | 166 | No hit | No description |
Pfam | PF00249 | 4.4E-12 | 122 | 166 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MIGDAANNST DMIQSNSTWT RFEDKQFEQA LVLYSENDVE RWQKIANHVP GRTVEDVMMH 60 YDTLVHDVFE IDSGRVEPPS YPDDDGGFGG DWDELDGGKL SQISFGGGAS KKQEVERKKG 120 TPWTEEEHRL FLIGLDKYGK GDWRSISRNV VVTRTPTQVA SHAQKYYLRQ QSMKKERKRS 180 SIHDITTAVD TKMVPPQNSL QNQGAYQNFN FPM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT012856 | 1e-130 | BT012856.1 Lycopersicon esculentum clone 113942F, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016551180.1 | 1e-159 | PREDICTED: transcription factor DIVARICATA-like isoform X1 | ||||
Swissprot | Q9FNN6 | 6e-61 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A2G2Y6R5 | 1e-158 | A0A2G2Y6R5_CAPAN; Transcription factor DIVARICATA | ||||
TrEMBL | A0A2G3AV26 | 1e-158 | A0A2G3AV26_CAPCH; Transcription factor DIVARICATA | ||||
STRING | XP_009796939.1 | 1e-122 | (Nicotiana sylvestris) | ||||
STRING | XP_009618932.1 | 1e-122 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4547 | 22 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 4e-71 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|