PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g02780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 597aa    MW: 64897.4 Da    PI: 4.7443
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g02780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.13e-1372125821374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 lv++L++cAeav++++++la+al+ ++  la ++  +m+++a+yf+eALa+r+++        ++p+++ e++  ++l++   f+e++P+lkf+h+taN
  CA12g02780 212 LVHTLMACAEAVQQENFNLADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IHPQDSIESSYNDVLQM--HFYETCPYLKFAHFTAN 300
                 689****************************************************........66777765555666554..5**************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaIlea+ ++++vH++Df+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++A+++gv+fef+ +va++l+dl+ ++L+++p
  CA12g02780 301 QAILEAFTNCNKVHVVDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDTLQQVGWKLAQLADTIGVEFEFRGFVANSLADLDASMLDIRP 399
                 *************************************************************************************************** PP

        GRAS 199 ..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres........eerikvEr 287
                    Ea+aVn+v++lhrll++++++e+    vL+ +++++Pk+v++veqea+hn++ F +rf eal+yys++fdsle++ ++++        +++  +++
  CA12g02780 400 seTEAVAVNSVFELHRLLARQGAIEK----VLDSIRQMNPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLESSSSSHNgitqspvtNQDLLMSE 494
                 999*******************9999....*********************************************9995554455555666999***** PP

        GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +lgr+i+nvva eg++r+erhe+l++Wr+rl++aGF pv+l+++a kqa++ll+ ++ +dgyrv+e++g+l+lgW++rpL+++SaW+
  CA12g02780 495 IYLGRQICNVVAYEGSDRVERHESLGQWRARLSSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVDENDGCLMLGWHTRPLIATSAWQ 582
                 ***************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.0E-3532105No hitNo description
PfamPF120413.4E-353298IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.458186561IPR005202Transcription factor GRAS
PfamPF035141.0E-134212582IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MKRDRDREKG SSSKGKNWAS VEEEEQPDAG MDELLAVLGY KVKSSDMAEV AQKLEQLEMA  60
MGTSMEDGIS HLSTDTVHKN PSDLSGWVQS MLSGLNSTSI SSNFGMSSSE NQLIVSGDGG  120
GGSCSSIIDF SRGNEEKKTT TAISDDDLRA IPGGAVFSSG RNRNEVDEES NKRQRSSFCS  180
SGGSNSSSGG NSLTDSARPV VLVDSQETGV RLVHTLMACA EAVQQENFNL ADALVRHIGI  240
LAVSQSGAMR KVATYFAEAL ARRIYKIHPQ DSIESSYNDV LQMHFYETCP YLKFAHFTAN  300
QAILEAFTNC NKVHVVDFSL KQGMQWPALM QALALRPGGP PAFRLTGIGP PQPDNTDTLQ  360
QVGWKLAQLA DTIGVEFEFR GFVANSLADL DASMLDIRPS ETEAVAVNSV FELHRLLARQ  420
GAIEKVLDSI RQMNPKIVTL VEQEANHNAG VFIDRFNEAL HYYSTMFDSL ESSSSSHNGI  480
TQSPVTNQDL LMSEIYLGRQ ICNVVAYEGS DRVERHESLG QWRARLSSAG FDPVHLGSNA  540
FKQASMLLAL FAGGDGYRVD ENDGCLMLGW HTRPLIATSA WQIAAEDDGA GEVELH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-6621958126378Protein SCARECROW
5b3h_A6e-6621958125377Protein SCARECROW
5b3h_D6e-6621958125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016572499.10.0PREDICTED: DELLA protein GAI-like isoform X1
RefseqXP_016572500.10.0PREDICTED: DELLA protein GAI-like isoform X2
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A1U8GMV10.0A0A1U8GMV1_CAPAN; DELLA protein GAI
TrEMBLA0A2G2Y4R20.0A0A2G2Y4R2_CAPAN; DELLA protein GAI-like isoform X1
STRINGPGSC0003DMT4000405890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]