PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g20320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 996aa    MW: 109780 Da    PI: 4.766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g20320genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-184589348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEde+l +av+q+ g++Wk+Ia+++   Rt+ qc +rwqk+l
       CA11g20320 45 KWTPEEDEILRQAVQQFKGKSWKKIAECFK-DRTDVQCLHRWQKVL 89
                     8****************************9.************986 PP

2Myb_DNA-binding55.51.3e-1795141148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd++l+++v+ +G+  W+ Ia+++  gR +kqc++rw+++l
       CA11g20320  95 KGSWSKEEDDKLIELVNIHGPQKWSNIAQELA-GRIGKQCRERWHNHL 141
                      799*****************************.*************97 PP

3Myb_DNA-binding54.52.7e-17147189145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ lv+a++ +G++ W+ I+++++ gR+++ +k++w+
       CA11g20320 147 KEAWTEEEELTLVRAHQAYGNK-WAEISKYLP-GRSDNAIKNHWH 189
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.343889IPR017930Myb domain
SuperFamilySSF466891.15E-153896IPR009057Homeodomain-like
SMARTSM007172.4E-154291IPR001005SANT/Myb domain
PfamPF002494.8E-164589IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-194599IPR009057Homeodomain-like
CDDcd001672.51E-144589No hitNo description
PROSITE profilePS5129431.63790145IPR017930Myb domain
SuperFamilySSF466891.65E-3092188IPR009057Homeodomain-like
SMARTSM007171.6E-1794143IPR001005SANT/Myb domain
CDDcd001672.24E-1597141No hitNo description
PfamPF139211.9E-1798156No hitNo description
Gene3DG3DSA:1.10.10.604.2E-26100148IPR009057Homeodomain-like
PROSITE profilePS5129422.217146196IPR017930Myb domain
SMARTSM007171.1E-16146194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-22149196IPR009057Homeodomain-like
CDDcd001671.49E-12149189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 996 aa     Download sequence    Send to blast
MLDYQDLSLS QVTMESDETS KPPSDDISSR PLHGRTSGPK RRSVKWTPEE DEILRQAVQQ  60
FKGKSWKKIA ECFKDRTDVQ CLHRWQKVLD PELVKGSWSK EEDDKLIELV NIHGPQKWSN  120
IAQELAGRIG KQCRERWHNH LNPEIKKEAW TEEEELTLVR AHQAYGNKWA EISKYLPGRS  180
DNAIKNHWHS SVKKKLASGL LAQSPALPNV NHQNQSTASS SMKLQETSED ESVHKEGAEV  240
EEVTECSQGS TLAGCPQSTS DLGNTFMHIR ENDAMLEESI HKKDASSGAA PCPRNSASAF  300
QDVSCSMLNV PSDLVDSKFL EYMFSHDGDN STERDWQFNM DDFPGFIEES SGHYMHCSND  360
NENHAMVADP LQTAMGSGAT SNAANMVEGP YKPNEMFDGC RIVYPEAAIS QCSPSETGVN  420
GTGEPADCLI YQSSNYQIPE EGNMAPPNCN ALSFDDVEAS THQQFSVPSH FSSEDRSLVF  480
GIASDQFHYP PLENSVLESF TSRCDDFICP SEFGSPSNDN GIDNAVLKDL PDHTKDSSRL  540
EEQKDGGALC YEPPRFPSLD VPFLYCDLIQ SGSNTQQEYS PLGIRHLMMS PANCLTPLRL  600
WNSPSGDDSP NAILKSAAKT FTGTPSIVKK RQRHLVSPLS EKRCEKKLES DLNQESFSNM  660
ATELSRVGDM FNEPANEKPS TEDKENLHPS SEDGRKEQGD GVTGLSCIEN SERQLDGGGA  720
HYHKDPNSES AGANDALGKV KQPPGVLVER SSNDMLVSPD RFLIKCDRAT SLSNKALDNQ  780
YAGQLEAASN QVNVSSSFET SFLSVFCSPD ILGKCRSSVV KATSMQSTTS TALVNTAENS  840
EKGFGAETSN IFGEAPLKRS TESPSAWKSP WSLNSFLPSP RYDTELTFED FAPFMSPGER  900
SYDAIGLMKQ LSEQTAPSIA DARQILGSET PETILSKRTK QQKADEDCAL LASNAMSERR  960
TLDFSECVTP PRKGKETTKF GSISSPSSYL LKCCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-65221968159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-65221968159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546938.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A2G2YI290.0A0A2G2YI29_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000478250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-158myb domain protein 3r-4