PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g14620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 259aa    MW: 29652 Da    PI: 8.8954
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g14620genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +++++G+ +W+  +++ g+ R++k+c++rw +yl
       CA11g14620 14 KGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding58.51.5e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eEde+++++++qlG++ W++Ia +++ gR+++++k++w++
       CA11g14620  67 RGNYTKEEDEIILNLHAQLGNK-WSAIAVHLP-GRSDNEIKNHWHT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.276961IPR017930Myb domain
SuperFamilySSF466891.03E-2911108IPR009057Homeodomain-like
SMARTSM007174.6E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-231568IPR009057Homeodomain-like
CDDcd001677.66E-91661No hitNo description
PROSITE profilePS5129425.64462116IPR017930Myb domain
SMARTSM007178.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.1E-1667110IPR001005SANT/Myb domain
CDDcd001672.62E-1169110No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2669115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MVRTPCHDEK GRKKGTWTPE EDRKLAAYIT KYGSWNWRQL PKYAGLARCG KSCRLRWMNY  60
LRPNVKRGNY TKEEDEIILN LHAQLGNKWS AIAVHLPGRS DNEIKNHWHT ALKKRANYAS  120
TSSDVSSKKS NKKKNSGSNT RRTSTSVENK NASSSMSIVA SHENIVLESS DWSPKKSSSE  180
EFSSYNTTDY QEQHKIFQEA LEDITSGSFW TEPFVVESFN TTRIDFLAPS IDCELMCPPS  240
PFIGQEFLSS FDFDHYNW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29141177109B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579452.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ9SJX85e-55MYB14_ARATH; Transcription factor MYB14
TrEMBLA0A2G2XZS60.0A0A2G2XZS6_CAPAN; Myb-related protein
STRINGSolyc07g053230.2.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.19e-55myb domain protein 107
Publications ? help Back to Top
  1. Chen Y, et al.
    AtMYB14 Regulates Cold Tolerance in Arabidopsis.
    Plant Mol. Biol. Rep., 2013. 31: p. 87-97
    [PMID:24415840]