PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g13580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 221aa    MW: 25952.9 Da    PI: 7.5968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g13580genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv +vk++G ++W+  a+  g++Rt+k+c++rw +yl
       CA11g13580  9 RGPWTEEEDLQLVFYVKLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 56
                     89********************************************97 PP

2Myb_DNA-binding52.51.1e-1662107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+   ++++ ++G++ W++Iar+++ gRt++++k++w++++
       CA11g13580  62 RGKMTPQEERVVLELHSKWGNR-WSRIARKIP-GRTDNEIKNYWRTHM 107
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.871456IPR017930Myb domain
SuperFamilySSF466891.47E-288103IPR009057Homeodomain-like
SMARTSM007171.7E-13858IPR001005SANT/Myb domain
PfamPF002498.0E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-211063IPR009057Homeodomain-like
CDDcd001677.40E-91156No hitNo description
PROSITE profilePS5129426.93757111IPR017930Myb domain
SMARTSM007171.4E-1561109IPR001005SANT/Myb domain
PfamPF002497.7E-1562106IPR001005SANT/Myb domain
CDDcd001671.86E-964107No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2364110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAQEEIMRRG PWTEEEDLQL VFYVKLFGDR RWDFLAKVSG LKRTGKSCRL RWVNYLNPDL  60
KRGKMTPQEE RVVLELHSKW GNRWSRIARK IPGRTDNEIK NYWRTHMRKK AQEQRKKSSI  120
SPSSSFSNSS SSSSISHEEX NFYDTGGLEL LKAEGEMKSS DQEQGGESMK IYSMDEIWKD  180
IELLEENEET TNKPIMGSIS PLWDYSLDSL WKDFDWSSFR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2991114105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-29711125128MYB TRANSFORMING PROTEIN
1mse_C1e-2961111105C-Myb DNA-Binding Domain
1msf_C1e-2961111105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0131101e-161BT013110.1 Lycopersicon esculentum clone 114397F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548288.11e-133PREDICTED: transcription factor MYB48
SwissprotQ9LX822e-76MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A2G2YGD31e-158A0A2G2YGD3_CAPAN; Transcription factor MYB48
STRINGPGSC0003DMT4000401491e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.17e-75myb domain protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Imran QM, et al.
    Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes.
    Sci Rep, 2018. 8(1): p. 771
    [PMID:29335449]