PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA11g11150 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 225aa MW: 25986.4 Da PI: 6.7144 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37 | 8e-12 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W eEd +l + + G +W+++++ g+ R++k+c++rw +yl CA11g11150 14 RGPWKIEEDHKLMNFILNNGIQCWRLVPKLAGLMRCGKSCRLRWINYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.4e-17 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ E++++++++ lG++ W++Ia++++ gRt++++k++w++ CA11g11150 67 RGALTEAEEDIIIKLHSHLGNR-WSKIAAHFP-GRTDNEIKNHWNT 110 7889******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.6E-20 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.083 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.81E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-4 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-10 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00255 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.988 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-15 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.47E-11 | 71 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MGRQPCCDNI GLKRGPWKIE EDHKLMNFIL NNGIQCWRLV PKLAGLMRCG KSCRLRWINY 60 LRPDLKRGAL TEAEEDIIIK LHSHLGNRWS KIAAHFPGRT DNEIKNHWNT RIKKKLKFLG 120 IDPLTHKPIE QNDDIKQQVS VEIDENVKEL AEKTLDYPRE QQNIQNSTSS SSLNESLDVG 180 SSSEIFQNSH TLDMYNPGVE DPFQNWIGSP IHWDLFDNLE DNFL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-28 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00510 | DAP | Transfer from AT5G14340 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975444 | 3e-51 | HG975444.1 Solanum pennellii chromosome ch05, complete genome. | |||
GenBank | HG975517 | 3e-51 | HG975517.1 Solanum lycopersicum chromosome ch05, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016546802.1 | 1e-165 | PREDICTED: protein ODORANT1-like | ||||
Refseq | XP_016546803.1 | 1e-165 | PREDICTED: protein ODORANT1-like | ||||
Refseq | XP_016546805.1 | 1e-165 | PREDICTED: protein ODORANT1-like | ||||
Swissprot | Q50EX6 | 1e-73 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A2G2YFN1 | 1e-165 | A0A2G2YFN1_CAPAN; Myb-related protein | ||||
STRING | Solyc05g014290.2.1 | 1e-125 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14340.1 | 5e-81 | myb domain protein 40 |
Publications ? help Back to Top | |||
---|---|---|---|
|