PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g11150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 225aa    MW: 25986.4 Da    PI: 6.7144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g11150genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding378e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W  eEd +l + +   G  +W+++++  g+ R++k+c++rw +yl
       CA11g11150 14 RGPWKIEEDHKLMNFILNNGIQCWRLVPKLAGLMRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding52.98.4e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+ E++++++++  lG++ W++Ia++++ gRt++++k++w++
       CA11g11150  67 RGALTEAEEDIIIKLHSHLGNR-WSKIAAHFP-GRTDNEIKNHWNT 110
                      7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-20564IPR009057Homeodomain-like
PROSITE profilePS5129414.083961IPR017930Myb domain
SuperFamilySSF466897.81E-2711108IPR009057Homeodomain-like
SMARTSM007177.2E-41363IPR001005SANT/Myb domain
PfamPF002493.1E-101461IPR001005SANT/Myb domain
CDDcd001670.002551661No hitNo description
PROSITE profilePS5129427.98862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565117IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002494.2E-1567110IPR001005SANT/Myb domain
CDDcd001679.47E-1171110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRQPCCDNI GLKRGPWKIE EDHKLMNFIL NNGIQCWRLV PKLAGLMRCG KSCRLRWINY  60
LRPDLKRGAL TEAEEDIIIK LHSHLGNRWS KIAAHFPGRT DNEIKNHWNT RIKKKLKFLG  120
IDPLTHKPIE QNDDIKQQVS VEIDENVKEL AEKTLDYPRE QQNIQNSTSS SSLNESLDVG  180
SSSEIFQNSH TLDMYNPGVE DPFQNWIGSP IHWDLFDNLE DNFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtR2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-51HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-51HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546802.11e-165PREDICTED: protein ODORANT1-like
RefseqXP_016546803.11e-165PREDICTED: protein ODORANT1-like
RefseqXP_016546805.11e-165PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-73ODO1_PETHY; Protein ODORANT1
TrEMBLA0A2G2YFN11e-165A0A2G2YFN1_CAPAN; Myb-related protein
STRINGSolyc05g014290.2.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.15e-81myb domain protein 40
Publications ? help Back to Top
  1. Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC
    ODORANT1 regulates fragrance biosynthesis in petunia flowers.
    Plant Cell, 2005. 17(5): p. 1612-24
    [PMID:15805488]