PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA11g05380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 160aa MW: 17768.1 Da PI: 7.6082 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 186.1 | 5.9e-58 | 3 | 120 | 22 | 139 |
Whirly 22 dsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgne 120 +sg++kl+r+G ++l++a+a+++r+ydW++kq+f+ls+te++++++l++k+sceffhdp ++ s+eG+vrk+lkvePlpdGsG+f+nlsv+n+l++ +e CA11g05380 3 QSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGAKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSGHFFNLSVQNKLINLDE 101 69************************************************************************************************* PP Whirly 121 sfsvPvskaefavlrsllv 139 ++++Pv+kaefavl s+++ CA11g05380 102 NIYIPVTKAEFAVLVSAFN 120 ***************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF08536 | 2.4E-53 | 2 | 117 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 2.7E-64 | 3 | 142 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 9.42E-67 | 3 | 159 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0042162 | Molecular Function | telomeric DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MEQSGAFKLS REGMVMLQFA PAAGVRQYDW SRKQVFSLSV TEIGSIISLG AKDSCEFFHD 60 PNKGRSDEGR VRKVLKVEPL PDGSGHFFNL SVQNKLINLD ENIYIPVTKA EFAVLVSAFN 120 FVVPYLLGWH TAANSFKPED TSRSNNANPR SGAELEWNR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 1e-110 | 4 | 158 | 65 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 1e-110 | 4 | 158 | 65 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 1e-110 | 4 | 158 | 65 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 1e-110 | 4 | 158 | 65 | 219 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF233342 | 0.0 | AF233342.1 Solanum tuberosum DNA-binding protein p24 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016548546.1 | 1e-113 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9LL85 | 1e-112 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A1U8EQ77 | 1e-112 | A0A1U8EQ77_CAPAN; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A2G2YDT6 | 1e-112 | A0A2G2YDT6_CAPAN; single-stranded DNA-binding protein WHY1, chloroplastic | ||||
STRING | PGSC0003DMT400045439 | 1e-110 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7731 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 8e-95 | ssDNA-binding transcriptional regulator |