PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g04390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 347aa    MW: 39449.6 Da    PI: 8.5387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g04390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  + ++G g+W++ +++ g+ R++k+c++rw +yl
       CA11g04390 14 KGPWTAEEDQKLLSFIDKHGCGSWRALPAKAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.58.5e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E+  +++++++lG++ W++Ia +++  Rt++++k++w++
       CA11g04390  67 RGKFSLQEERTIIHLHALLGNR-WSAIATYLP-SRTDNEIKNYWNS 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.223961IPR017930Myb domain
SuperFamilySSF466891.12E-2911108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001677.15E-101661No hitNo description
PROSITE profilePS5129424.12362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
SMARTSM007179.0E-1566114IPR001005SANT/Myb domain
PfamPF002493.6E-1467110IPR001005SANT/Myb domain
CDDcd001671.07E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGKSKCSDKE GLKKGPWTAE EDQKLLSFID KHGCGSWRAL PAKAGLQRCG KSCRLRWINY  60
LRPDIKRGKF SLQEERTIIH LHALLGNRWS AIATYLPSRT DNEIKNYWNS RLKKRLTKMG  120
IDPMTHKPKI TNNLNGVASS KYVATLSHMA EWESARLEAE ARLVRKSKDY EILFNNNNYN  180
INRSTISQQL PYYQLPCLDI LKAWQMSSTK LPTINDISAI LLNNSRNNNL ESSIPSTLHS  240
SETLFVNNNV PTTTTTTANV RDDHQIPPNL STIESCFEDD QLQTDLPSFM QEFSGLFPEY  300
YTQNSTNIQV DNLMGCCSGD FEDNKLINWN NFPNYLVNSP IGSPVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546904.10.0PREDICTED: transcription factor MYB76-like
SwissprotQ9LE633e-94MY106_ARATH; Transcription factor MYB106
TrEMBLA0A2G2XXX70.0A0A2G2XXX7_CAPAN; Transcription factor MYB39
STRINGPGSC0003DMT4000474460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.15e-92myb domain protein 16