PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g04240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 346aa    MW: 38198.6 Da    PI: 8.4711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g04240genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-16114159147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
       CA11g04240 114 RGHWRPAEDAQLKELVAIYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 159
                      899*****************************.***********996 PP

2Myb_DNA-binding55.21.7e-17166209146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l  a++++G++ W+ Iar ++ gRt++ +k++w+ 
       CA11g04240 166 RRAFSEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 209
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.117109160IPR017930Myb domain
SMARTSM007172.6E-14113162IPR001005SANT/Myb domain
SuperFamilySSF466891.54E-27114207IPR009057Homeodomain-like
PfamPF002491.5E-15114159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-25115167IPR009057Homeodomain-like
CDDcd001674.08E-13117158No hitNo description
PROSITE profilePS5129426.846161215IPR017930Myb domain
SMARTSM007174.4E-14165213IPR001005SANT/Myb domain
PfamPF002494.5E-14166208IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-20168214IPR009057Homeodomain-like
CDDcd001673.32E-11168208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGGASTSMGM FFADMNSLSI NTPKSVDEGK GRKGSWDFQF LNKGGAVFSC CQNLDEVQNS  60
EENNESIDLN ASCYNEEKQI TLHSTFNSNN SSSGGGGGNN GKETESGQSK LCARGHWRPA  120
EDAQLKELVA IYGPQNWNLI AEKLEGRSGK SCRLRWFNQL DPRINRRAFS EEEEERLMAA  180
HRLYGNKWAM IARLFPGRTD NAVKNHWHVI MARKYREQSS AYRRRKMGQF VYRRSTLVVE  240
EADSGKAQAP IISCQNSVNQ FGATANTTSV KINNDGPNGW VVYEPNGSPH MTVSAGEAAA  300
ATPSSTNNVT LLSPYSPFCA PPFDSLPAGI FRSIPFNNLF HQLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-321142147107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9833311e-144HG983331.1 Nicotiana benthamiana mRNA for SANT/HTH Myb transcription factor (SANT/HTH Myb gene), clone 3890.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571686.10.0PREDICTED: uncharacterized protein LOC107869748
TrEMBLA0A1U8GK910.0A0A1U8GK91_CAPAN; Transcription factor MYB44
TrEMBLA0A2G2YDY50.0A0A2G2YDY5_CAPAN; uncharacterized protein LOC107869748
STRINGSolyc05g007870.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-76myb domain protein 105