PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA10g20490 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 163aa MW: 18518.6 Da PI: 10.2886 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 94.6 | 1.1e-29 | 15 | 71 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq Rak+ ++k+ ksrkpylheSRh+hA+rR+R gGrF CA10g20490 15 EEPMYVNAKQYHGILRRRQLRAKAVLQQKV-VKSRKPYLHESRHRHAMRRARDGGGRF 71 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 7.2E-33 | 13 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 34.792 | 14 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.3E-26 | 16 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.9E-22 | 17 | 39 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.9E-22 | 48 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MHHNGRMILP IEVKEEPMYV NAKQYHGILR RRQLRAKAVL QQKVVKSRKP YLHESRHRHA 60 MRRARDGGGR FLNTKKNNQH PTNNNNNNAT ASSEGKGGSL VSDSSANYLL NYEQDIGSSN 120 NGEGFQFQGI HGTTKENLQL GCHYQWNLND NNHCNCMHSA HF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-20 | 15 | 78 | 2 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 55 | 64 | RHRHAMRRAR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016543840.1 | 1e-118 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q84JP1 | 2e-29 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2G2YP27 | 1e-118 | A0A2G2YP27_CAPAN; Nuclear transcription factor Y subunit A-7 | ||||
STRING | Solyc10g079150.1.1 | 1e-77 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13392 | 15 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12840.4 | 9e-30 | nuclear factor Y, subunit A1 |
Publications ? help Back to Top | |||
---|---|---|---|
|