PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g15650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 130aa    MW: 15281.6 Da    PI: 10.381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g15650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEde+l+  v+  G ++W++ a+  g++R++k+c++rw++yl
       CA10g15650 14 RGQWLEEEDERLAMIVAISGERRWDALAKDSGLKRSGKSCRLRWLNYL 61
                     899********************************************7 PP

2Myb_DNA-binding52.11.5e-1670112448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       T++E+ l++++ kq+G++ W++Ia+ ++ gRt++++k++w+++l
       CA10g15650  70 ITADEERLIIRLQKQFGNK-WSKIAKQLP-GRTDNEIKNYWRSHL 112
                      59*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.818961IPR017930Myb domain
SuperFamilySSF466893.67E-2712108IPR009057Homeodomain-like
SMARTSM007172.5E-111363IPR001005SANT/Myb domain
PfamPF002494.5E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-201568IPR009057Homeodomain-like
CDDcd001671.08E-71761No hitNo description
PROSITE profilePS5129426.29562116IPR017930Myb domain
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-2569115IPR009057Homeodomain-like
PfamPF002491.1E-1470112IPR001005SANT/Myb domain
CDDcd001673.76E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MSSQLTMQEE ELRRGQWLEE EDERLAMIVA ISGERRWDAL AKDSGLKRSG KSCRLRWLNY  60
LRPNLKHGHI TADEERLIIR LQKQFGNKWS KIAKQLPGRT DNEIKNYWRS HLRKKAPVYE  120
QGLLKYSAC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27111161105MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-271111655159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-271111655159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754493e-59HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755223e-59HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543396.13e-84PREDICTED: transcription factor MYB48-like
SwissprotQ9SCP15e-50MYB27_ARATH; Transcription factor MYB27
TrEMBLA0A1U8EAE56e-83A0A1U8EAE5_CAPAN; transcription factor MYB48-like
STRINGPGSC0003DMT4000726874e-79(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.12e-52myb domain protein 27
Publications ? help Back to Top
  1. Albert NW, et al.
    A conserved network of transcriptional activators and repressors regulates anthocyanin pigmentation in eudicots.
    Plant Cell, 2014. 26(3): p. 962-80
    [PMID:24642943]