PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA10g15650 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 130aa MW: 15281.6 Da PI: 10.381 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.7 | 1.8e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEde+l+ v+ G ++W++ a+ g++R++k+c++rw++yl CA10g15650 14 RGQWLEEEDERLAMIVAISGERRWDALAKDSGLKRSGKSCRLRWLNYL 61 899********************************************7 PP | |||||||
2 | Myb_DNA-binding | 52.1 | 1.5e-16 | 70 | 112 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T++E+ l++++ kq+G++ W++Ia+ ++ gRt++++k++w+++l CA10g15650 70 ITADEERLIIRLQKQFGNK-WSKIAKQLP-GRTDNEIKNYWRSHL 112 59*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.818 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-27 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-20 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.08E-7 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.295 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-25 | 69 | 115 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-14 | 70 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.76E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MSSQLTMQEE ELRRGQWLEE EDERLAMIVA ISGERRWDAL AKDSGLKRSG KSCRLRWLNY 60 LRPNLKHGHI TADEERLIIR LQKQFGNKWS KIAKQLPGRT DNEIKNYWRS HLRKKAPVYE 120 QGLLKYSAC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-27 | 11 | 116 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 9e-27 | 11 | 116 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 9e-27 | 11 | 116 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975449 | 3e-59 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
GenBank | HG975522 | 3e-59 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016543396.1 | 3e-84 | PREDICTED: transcription factor MYB48-like | ||||
Swissprot | Q9SCP1 | 5e-50 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A1U8EAE5 | 6e-83 | A0A1U8EAE5_CAPAN; transcription factor MYB48-like | ||||
STRING | PGSC0003DMT400072687 | 4e-79 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 2e-52 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|