PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g08070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 264aa    MW: 29897.8 Da    PI: 7.945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g08070genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+d+++ +G g+W++ ++  g+ R++k+ ++rw +yl
       CA10g08070 14 KGAWTKEEDERLIDYIRAHGEGCWRALPKAAGLLRCGKSFRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k +w+++
       CA10g08070  67 RGNFTEEEDELIIRLHSLLGNK-WSLIAGRLP-GRTDNEIKKYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.103961IPR017930Myb domain
SuperFamilySSF466891.3E-2713108IPR009057Homeodomain-like
SMARTSM007171.3E-101363IPR001005SANT/Myb domain
PfamPF002495.1E-131461IPR001005SANT/Myb domain
CDDcd001671.14E-81661No hitNo description
PROSITE profilePS5129428.78362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2765116IPR009057Homeodomain-like
SMARTSM007172.0E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1667111IPR001005SANT/Myb domain
CDDcd001677.35E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLIDYIR AHGEGCWRAL PKAAGLLRCG KSFRLRWINY  60
LRPDLKRGNF TEEEDELIIR LHSLLGNKWS LIAGRLPGRT DNEIKKYWNT HIRRKLLSRG  120
IDPTIHLSIN EPTPKVTTIT FAAAADSTDD HHRDQKINIK AEFDETSNED NNEVPKMSCL  180
PDLNLELRIS PPHHQQLDHH HQRSNSLCFT CGLGIQNSKD CSCNNTNGIG CSNNIVSVNI  240
VTGYDFLGLK TNGLLDYRTL ETK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX952960.0X95296.1 L.esculentum mRNA for THM27 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233975.11e-158transcription factor
SwissprotP813931e-111MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A2G2YKW80.0A0A2G2YKW8_CAPAN; Myb-related protein Hv1
STRINGSolyc10g055410.1.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-104myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]