PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g05260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 357aa    MW: 40929.5 Da    PI: 6.0837
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g05260genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
       CA10g05260 13 RGLWSPEEDEKLIRHITTHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding52.31.3e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
       CA10g05260  66 RGSFTEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25462IPR009057Homeodomain-like
PROSITE profilePS5129418.019860IPR017930Myb domain
SuperFamilySSF466895.99E-2910107IPR009057Homeodomain-like
SMARTSM007172.6E-131262IPR001005SANT/Myb domain
PfamPF002492.2E-151360IPR001005SANT/Myb domain
CDDcd001672.28E-111660No hitNo description
PROSITE profilePS5129425.97761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2563116IPR009057Homeodomain-like
SMARTSM007171.5E-1565113IPR001005SANT/Myb domain
PfamPF002492.8E-1566109IPR001005SANT/Myb domain
CDDcd001672.17E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLIRHITT HGHGCWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLRRGSFT EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPNTHNLLKN KSNNPTKKSD YTYHHQDSTS VFTIDTSTNK EVISMDLKST LATLSPNFPP  180
SDNIITSSTY NYTPIVPNIE YQNPTFAWSE ERNQSTLTML QSQTSERNLV TTRDSILDFA  240
SNCSLMESTT NINVSSYINE NRMWNGTGLE PTTLNPVNGQ EEEMQVQLQG DQQFPIIQTK  300
FCHDQEDVYK VNDHDQTVEN TFDDNSNFDF EFMNSAFVPC GLYTNDNSMD QLSWDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-132HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544702.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A1U8EBX30.0A0A1U8EBX3_CAPAN; myb-related protein 330-like
STRINGSolyc10g005240.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-84myb domain protein 67