PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g03650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 330aa    MW: 37733 Da    PI: 6.5999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g03650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G+g+W+  ++  g+ R++k+c++rw +yl
       CA10g03650 14 KGPWTPEEDQKLIQYIQVHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.23.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       CA10g03650  67 RGRFSFEEEETIIQLHSVLGNK-WSAIAERLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.83965IPR017930Myb domain
SuperFamilySSF466891.39E-3111108IPR009057Homeodomain-like
SMARTSM007174.7E-151363IPR001005SANT/Myb domain
PfamPF002496.4E-171461IPR001005SANT/Myb domain
CDDcd001679.17E-131661No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2665116IPR009057Homeodomain-like
SMARTSM007175.9E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.41266116IPR017930Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001677.73E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLIQYIQ VHGPGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIRRGRF SFEEEETIIQ LHSVLGNKWS AIAERLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DFLDFSLLFN STQLNLSSLL GLQALVNPEI FKLANSILLS QTHENQELSL  180
QNQNSQGPEL LLQKLQQNQL LHNQSSIFQH NDQLHNQISK IPNYTPQNVS SSSSQSIQGN  240
MGSYLMNGQA FHENVISLQN YSYSASEVSE NSTIQSLNNN NNNNNQNSQN FNFDTPLSGT  300
EEEKESYCSN FNSFMKFEIP ESLDFDDLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2447210.0AC244721.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-58o17 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544693.10.0PREDICTED: transcription factor MYB34-like
SwissprotQ9LDR81e-100MY102_ARATH; Transcription factor MYB102
TrEMBLA0A2G3BCX40.0A0A2G3BCX4_CAPCH; Transcription factor MYB34
STRINGSolyc10g008700.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.12e-87myb domain protein 41
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  4. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]