PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g01010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 319aa    MW: 35616.7 Da    PI: 8.1707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g01010genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
       CA10g01010 14 RGQWTPEEDHKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding46.11.1e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E++ +v ++  lG++ W+ Ia+ ++ gRt++++k++w++
       CA10g01010  68 GQFSEAEEQTIVTLHSVLGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.352965IPR017930Myb domain
SuperFamilySSF466892.46E-2911108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-171461IPR001005SANT/Myb domain
CDDcd001675.02E-111761No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.45566116IPR017930Myb domain
SMARTSM007173.7E-1366114IPR001005SANT/Myb domain
PfamPF002493.7E-1368110IPR001005SANT/Myb domain
CDDcd001677.53E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDHKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEQTIVT LHSVLGNRWS VIAAQLPGRT DNDVKNHWNT KLKKRLSGMG  120
IDPVTHKPFS HLISEIATTL SPPQVPHLAE AALGCFKDEM LHLLTKKRIG FQFHQQFPNN  180
APSTSHVKNE ENDTVEKIKY GLSRAIKGSD KNWETNGGAT SSSFHDNGGY SNYNFANLLN  240
DEDGSPWNQS LCSGSTCTAG GELQQQQQQQ RNKKTSNGNC EDSGKEVVTT RNGSTTTMFN  300
SDCVLWDISS DDLMNPMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtEssential for tapetum development in anthers and microsporogenesis. May regulate the timing of tapetal programmed cell death (PCD) which is critical for pollen development. {ECO:0000269|PubMed:22086333}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4157550.0HQ415755.1 Lycium barbarum putative Myb103 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545653.10.0PREDICTED: protein ODORANT1
SwissprotQ7XQN11e-117MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A2G3BCC90.0A0A2G3BCC9_CAPCH; Transcription factor MYB39
STRINGSolyc10g005760.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-116myb domain protein 103