PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g00800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 226aa    MW: 25920.1 Da    PI: 8.8645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g00800genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++++G g+W++ ++  g+ R++k+c++rw +yl
       CA10g00800 16 KGPWTPEEDLKLISFIQKHGHGNWRALPKQAGLVRCGKSCRLRWINYL 63
                     79******************************99************97 PP

2Myb_DNA-binding51.72.1e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
       CA10g00800  69 RGNFTSQEEDTIINLHRSFGNR-WSKIASHLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-26866IPR009057Homeodomain-like
PROSITE profilePS5129417.6151163IPR017930Myb domain
SuperFamilySSF466893.15E-3114110IPR009057Homeodomain-like
SMARTSM007171.1E-141565IPR001005SANT/Myb domain
PfamPF002491.8E-161663IPR001005SANT/Myb domain
CDDcd001672.26E-111863No hitNo description
PROSITE profilePS5129424.37664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2767118IPR009057Homeodomain-like
SMARTSM007171.0E-1468116IPR001005SANT/Myb domain
PfamPF002494.9E-1569114IPR001005SANT/Myb domain
CDDcd001671.08E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGKGRRSCCD KSKVKKGPWT PEEDLKLISF IQKHGHGNWR ALPKQAGLVR CGKSCRLRWI  60
NYLRPDVKRG NFTSQEEDTI INLHRSFGNR WSKIASHLPG RTDNEIKNVW NTHLKKRLLL  120
MKKEEHNSPS STPTCSSTTL GSCSPTSSKA NDQVIDFWEY MLDTSNPTSI NNLDHFDSYS  180
KQDTTSTNTE HHQPQMADEY ECQKWLTYLE IELGLTTNEA QHQIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28161187108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545358.11e-170PREDICTED: myb-related protein Myb4-like
SwissprotQ9SA473e-78MYB58_ARATH; Transcription factor MYB58
TrEMBLA0A1U8EDQ71e-168A0A1U8EDQ7_CAPAN; Transcription factor MYB32
TrEMBLA0A2G2YIH01e-168A0A2G2YIH0_CAPAN; myb-related protein Myb4-like
STRINGPGSC0003DMT4000292351e-129(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.17e-70myb domain protein 58
Publications ? help Back to Top
  1. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  2. Noda S, et al.
    The expression of a rice secondary wall-specific cellulose synthase gene, OsCesA7, is directly regulated by a rice transcription factor, OsMYB58/63.
    Planta, 2015. 242(3): p. 589-600
    [PMID:26070439]
  3. Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y
    Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.
    J. Plant Res., 2018. 131(2): p. 297-305
    [PMID:28921082]