PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g07680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 173aa    MW: 19872.4 Da    PI: 8.9441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g07680genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l+ ++++ G  +W+  ++  g+ R++k+c++rw++yl
       CA09g07680 15 KGTWTHEEDKKLAAYINRCGCWNWRQLPKFAGLSRCGKNCRLRWLNYL 62
                     799*****************99************************97 PP

2Myb_DNA-binding55.41.5e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eEde + +++++ G++ W++Ia +++ gR+++++k++w++
       CA09g07680  68 RGNFTKEEDETIMNLHAEIGNK-WSAIAVHLP-GRSDNEIKNHWHT 111
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.931062IPR017930Myb domain
SuperFamilySSF466891.91E-2912109IPR009057Homeodomain-like
SMARTSM007176.2E-81464IPR001005SANT/Myb domain
PfamPF002495.5E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-221669IPR009057Homeodomain-like
CDDcd001671.08E-61762No hitNo description
PROSITE profilePS5129424.75863117IPR017930Myb domain
SMARTSM007174.4E-1567115IPR001005SANT/Myb domain
PfamPF002497.3E-1668111IPR001005SANT/Myb domain
CDDcd001678.20E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MARTRCYDKK SGLKKGTWTH EEDKKLAAYI NRCGCWNWRQ LPKFAGLSRC GKNCRLRWLN  60
YLQPNIKRGN FTKEEDETIM NLHAEIGNKW SAIAVHLPGR SDNEIKNHWH TSLKKRLSIQ  120
ETSKKKSPNN VTQKSDDEDQ NISPNQSCTE VSSCATIDQN LENIMDGQCE VF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26131175108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in salt stress response. {ECO:0000305|PubMed:26139822}.
UniProtTranscriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}.
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:26139822}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567822.11e-126PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-51MYB4_ORYSJ; Transcription factor MYB4
SwissprotQ9M0Y52e-51MYB74_ARATH; Transcription factor MYB74
TrEMBLA0A2G2YTN51e-126A0A2G2YTN5_CAPAN; Transcription factor MYB51
STRINGPGSC0003DMT4000357484e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.11e-53myb domain protein 74
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Park MR, et al.
    Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.
    Plant Cell Environ., 2010. 33(12): p. 2209-30
    [PMID:20807373]
  3. Solt├ęsz A, et al.
    The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.
    J. Appl. Genet., 2012. 53(2): p. 133-43
    [PMID:22246661]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Xu R, et al.
    Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.
    J. Exp. Bot., 2015. 66(19): p. 5997-6008
    [PMID:26139822]
  6. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]