PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA09g07680 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 173aa MW: 19872.4 Da PI: 8.9441 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.1 | 4.7e-14 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd++l+ ++++ G +W+ ++ g+ R++k+c++rw++yl CA09g07680 15 KGTWTHEEDKKLAAYINRCGCWNWRQLPKFAGLSRCGKNCRLRWLNYL 62 799*****************99************************97 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.5e-17 | 68 | 111 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T+eEde + +++++ G++ W++Ia +++ gR+++++k++w++ CA09g07680 68 RGNFTKEEDETIMNLHAEIGNK-WSAIAVHLP-GRSDNEIKNHWHT 111 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.93 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.91E-29 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.2E-8 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.5E-13 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-22 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.08E-6 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 24.758 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 4.4E-15 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.3E-16 | 68 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.20E-10 | 70 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-26 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MARTRCYDKK SGLKKGTWTH EEDKKLAAYI NRCGCWNWRQ LPKFAGLSRC GKNCRLRWLN 60 YLQPNIKRGN FTKEEDETIM NLHAEIGNKW SAIAVHLPGR SDNEIKNHWH TSLKKRLSIQ 120 ETSKKKSPNN VTQKSDDEDQ NISPNQSCTE VSSCATIDQN LENIMDGQCE VF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-26 | 13 | 117 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in salt stress response. {ECO:0000305|PubMed:26139822}. | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:26139822}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016567822.1 | 1e-126 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q7XBH4 | 2e-51 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
Swissprot | Q9M0Y5 | 2e-51 | MYB74_ARATH; Transcription factor MYB74 | ||||
TrEMBL | A0A2G2YTN5 | 1e-126 | A0A2G2YTN5_CAPAN; Transcription factor MYB51 | ||||
STRING | PGSC0003DMT400035748 | 4e-98 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G05100.1 | 1e-53 | myb domain protein 74 |