PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g07480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 428aa    MW: 49328 Da    PI: 5.8396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g07480genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16173219148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+++G + W+ Ia+++  gR +kqc++rw+++l
       CA09g07480 173 KGQWTIEEDRLLIHLVEKFGIRKWSQIAQMLK-GRIGKQCRERWHNHL 219
                      799****************************9.*************97 PP

2Myb_DNA-binding54.82.2e-17226267245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + WT+eEd +l++a+ + G++ W+ Ia++++ gRt++++k++w+
       CA09g07480 226 DFWTEEEDRILIEAHGEVGNK-WAEIAKKLP-GRTENSIKNHWN 267
                      67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.235168223IPR017930Myb domain
SMARTSM007177.6E-15172221IPR001005SANT/Myb domain
PfamPF002491.3E-15173219IPR001005SANT/Myb domain
SuperFamilySSF466898.48E-32173266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-26174224IPR009057Homeodomain-like
CDDcd001677.81E-14176219No hitNo description
SMARTSM007173.9E-17224272IPR001005SANT/Myb domain
PROSITE profilePS5129422.225224274IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-22225273IPR009057Homeodomain-like
PfamPF002491.6E-15228267IPR001005SANT/Myb domain
CDDcd001673.89E-13228270No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MELDQSNNQN LSIHQPFFMP NNNILKPEID DDFCIDSKDY YLKDFEHLDL NFSNTTFNNF  60
SQNFMIDDDT NGTTYHDPFD PFSNIEDNFS SLGDFNFSSH ELTPFDQENG ESGGSKVMKN  120
NFHDDEFMKP NLNFVNVPDD QSSCVTGDNN LSSSIKKKLG GRGRPKKSSK SSKGQWTIEE  180
DRLLIHLVEK FGIRKWSQIA QMLKGRIGKQ CRERWHNHLR PDIKKDFWTE EEDRILIEAH  240
GEVGNKWAEI AKKLPGRTEN SIKNHWNATK RRQFSRRKCR TKWPRPSSLL QNYIKSLNLE  300
KGSTKKDTNP NGRVEYTGSV AENRNENLAN RPKRHANIAK VKVSPKLEAI EFCQDNNAGD  360
FDLSEVPEFA LGDNFFDENK SMDAFMEEIN PNVGTSIMPC NYEMPTLMMQ GEVNKEIDLI  420
EMISRVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-451732734104C-Myb DNA-Binding Domain
1msf_C3e-451732734104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192101e-107AC219210.1 Solanum lycopersicum chromosome 6 clone C06HBa0082B05, complete sequence.
GenBankAC2329441e-107AC232944.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 6 clone LE_HBa-24A16, complete sequence.
GenBankHG9755181e-107HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576336.10.0PREDICTED: transcription factor MYB98-like
TrEMBLA0A2G3C9U40.0A0A2G3C9U4_CAPCH; Myb-related protein A
STRINGSolyc06g071520.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-72myb domain protein 98