PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g05210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 403aa    MW: 45062.8 Da    PI: 7.6136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g05210genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171056148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd+ l++av  + g++Wk+Ia+ ++  R++ qc +rwqk+l
       CA09g05210 10 RGGWTPEEDDTLKKAVSVYRGKCWKKIAELFP-DRSEVQCLHRWQKVL 56
                     789*****************************.************986 PP

2Myb_DNA-binding57.92.2e-1862108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEd++++++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
       CA09g05210  62 KGPWTREEDDKIIELVAKYGPIKWSVIAKSLP-GRIGKQCRERWHNHL 108
                      79******************99**********.*************97 PP

3Myb_DNA-binding50.16.2e-16114157146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE+  l+da++ +G++ W+ Ia+ ++ gR ++ +k++w++
       CA09g05210 114 KDAWTLEEERALIDAHRIHGNK-WAEIAKVLP-GRADNGIKNHWNS 157
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.419556IPR017930Myb domain
SuperFamilySSF466891.51E-14660IPR009057Homeodomain-like
SMARTSM007174.5E-15958IPR001005SANT/Myb domain
PfamPF002498.8E-161056IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-211263IPR009057Homeodomain-like
CDDcd001671.47E-121356No hitNo description
PROSITE profilePS5129431.88557112IPR017930Myb domain
SuperFamilySSF466892.96E-3059155IPR009057Homeodomain-like
SMARTSM007171.4E-1861110IPR001005SANT/Myb domain
PfamPF002491.0E-1762108IPR001005SANT/Myb domain
CDDcd001678.76E-1664108No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2864112IPR009057Homeodomain-like
SMARTSM007175.3E-14113161IPR001005SANT/Myb domain
PROSITE profilePS5129421.279113163IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-22113163IPR009057Homeodomain-like
PfamPF002496.8E-14114157IPR001005SANT/Myb domain
CDDcd001671.90E-10116159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
KTTGPIRRAR GGWTPEEDDT LKKAVSVYRG KCWKKIAELF PDRSEVQCLH RWQKVLNPEL  60
VKGPWTREED DKIIELVAKY GPIKWSVIAK SLPGRIGKQC RERWHNHLNP NIKKDAWTLE  120
EERALIDAHR IHGNKWAEIA KVLPGRADNG IKNHWNSSLR KKLDFYLATG NLPSVKSEEL  180
LVCSIKTSEA ADVVSSGAID ICKIENGWQV TEISASNGGP QAESTDSEIV RLEAQSPEED  240
AIQRIKQSTE SENRCDGWNI DSAVGRLQVF EAPFPCEIST CGRLYYEPPR SESCIPLDSD  300
LLNIGWAQCE SDASPSPSPN GFFTPPSTKD HSLYAQTPES VLRIAARSFN TPSILRKRKS  360
QGKPSTPTNK MRKSDGDFCK DKLIDACDKV QFDSSDKSSM DN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-69101639159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-69101639159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016542418.10.0PREDICTED: myb-related protein B
RefseqXP_016542419.10.0PREDICTED: myb-related protein B
SwissprotQ6R0321e-116MB3R5_ARATH; Transcription factor MYB3R-5
TrEMBLA0A2G2YR200.0A0A2G2YR20_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000230120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54612437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-119myb domain protein 3r-5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Kobayashi K, et al.
    Transcriptional repression by MYB3R proteins regulates plant organ growth.
    EMBO J., 2015. 34(15): p. 1992-2007
    [PMID:26069325]
  3. Chen P, et al.
    Arabidopsis R1R2R3-Myb proteins are essential for inhibiting cell division in response to DNA damage.
    Nat Commun, 2017. 8(1): p. 635
    [PMID:28935922]