PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g02000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 312aa    MW: 34982.9 Da    PI: 6.7725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g02000genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++++ ++G+g +W + +++ g++R++k+c++rw++yl
       CA09g02000 14 KGPWSPEEDAKLKEYIDKFGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.36.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd  +  + +  G++ W+ Ia+ ++ gRt++++k++w++
       CA09g02000  69 GEFSDEEDRVICSLYANIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.633962IPR017930Myb domain
SuperFamilySSF466894.59E-2711109IPR009057Homeodomain-like
SMARTSM007177.6E-121364IPR001005SANT/Myb domain
PfamPF002495.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241569IPR009057Homeodomain-like
CDDcd001677.07E-91662No hitNo description
PROSITE profilePS5129421.88863117IPR017930Myb domain
SMARTSM007176.7E-1167115IPR001005SANT/Myb domain
PfamPF002491.5E-1069111IPR001005SANT/Myb domain
CDDcd001671.16E-770113No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKEYID KFGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDRVIC SLYANIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGF  120
VSSSHKIKPL NHHHYQHQIP TNYNYNNYSP QISLFQTSSL LISSNYNTNT NNTTFPCYDI  180
NAPISNFLSN GASTSCTSGI TTSTFQENNF VGPTATSSDE SYGVSNLDFH TYMYNNGVIG  240
EEGEDQGNSK FLISGNNGGG GCYVDEQQNP LDYSSLEEIK ELISTNHVTC NNNNLLLDHE  300
IKIEEKVMMY Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ2285911e-132JQ228591.1 Nicotiana tabacum ntrax mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016542794.10.0PREDICTED: transcription factor RAX2
TrEMBLA0A1U8EFZ70.0A0A1U8EFZ7_CAPAN; Transcription factor RAX1
TrEMBLA0A2G2YQ370.0A0A2G2YQ37_CAPAN; transcription factor RAX2
STRINGPGSC0003DMT4000099261e-175(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-79myb domain protein 36