PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g19210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 476aa    MW: 55465.8 Da    PI: 8.6382
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g19210genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
       CA08g19210 14 KGAWTKEEDERLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding58.91.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
       CA08g19210  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.1961IPR017930Myb domain
SMARTSM007175.2E-141363IPR001005SANT/Myb domain
SuperFamilySSF466891.29E-2913108IPR009057Homeodomain-like
PfamPF002493.3E-151461IPR001005SANT/Myb domain
CDDcd001673.16E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2865116IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002497.6E-1767111IPR001005SANT/Myb domain
CDDcd001674.11E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLIAYIR THGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLSRG  120
IDPTTHRPIN EPSTTQKVTT ISFAGGDHKT KDIEDQDYKM INVKAESGLS QVEDEINSSP  180
FREQFPDLNL ELRISPPSRQ NYQQSHHVQD FKQSPTRCFA CSLGIQNSKD CNCSXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  360
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXLLVL SSFEFLLYVK LQVLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281311626128MYB TRANSFORMING PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX952961e-129X95296.1 L.esculentum mRNA for THM27 protein.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-107myb domain protein 4