PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA08g13660 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 195aa MW: 22961.9 Da PI: 8.8619 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.2 | 9.6e-51 | 41 | 166 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ + CA08g13660 41 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTENSRSI 138 79***************************.89***************8778899********************************************* PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 glkktLvfy+g+apkg +++W+m+eyrl CA08g13660 139 GLKKTLVFYSGKAPKGIRSSWIMNEYRL 166 **************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.89E-54 | 40 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.419 | 40 | 184 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.6E-26 | 42 | 166 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MAIVPFTTTM SQSQQQQDHD NINNNTIKGD DDDDHEHDMV MPGFRFHPTE EELVEFYLRR 60 KVEGKRFNVE LITFLDLYRY DPWELPALAA IGEKEWYFYV PRDRKYRNGD RPNRVTTSGY 120 WKATGADRMI RTENSRSIGL KKTLVFYSGK APKGIRSSWI MNEYRLPQHE TERLQKVSCI 180 YIRSHHVLAL NSKI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-55 | 42 | 166 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-55 | 42 | 166 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-55 | 42 | 166 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-55 | 42 | 166 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-54 | 42 | 166 | 22 | 145 | NAC domain-containing protein 19 |
4dul_A | 9e-55 | 42 | 166 | 19 | 142 | NAC domain-containing protein 19 |
4dul_B | 9e-55 | 42 | 166 | 19 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00257 | DAP | Transfer from AT2G02450 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-117 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016538913.1 | 1e-132 | PREDICTED: NAC transcription factor 25 | ||||
Swissprot | Q9ZVP8 | 3e-96 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A1U8DV76 | 1e-131 | A0A1U8DV76_CAPAN; Putative NAC domain-containing protein 94 | ||||
TrEMBL | A0A2G2XXN5 | 1e-131 | A0A2G2XXN5_CAPAN; NAC transcription factor 25 | ||||
STRING | XP_009626107.1 | 1e-115 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3888 | 24 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 7e-96 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|