PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g06950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 311aa    MW: 34596.7 Da    PI: 6.9249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g06950genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde+lv+ +++ G g+W++ ++  g+ R++k+c++rw +yl
       CA08g06950 14 RGPWTPEEDEKLVEFINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding47.63.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
       CA08g06950  67 RGPFSPEEQKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.705961IPR017930Myb domain
SuperFamilySSF466892.49E-3012108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001672.37E-111661No hitNo description
PROSITE profilePS5129424.70362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2565116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002493.0E-1467112IPR001005SANT/Myb domain
CDDcd001671.76E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGRTPCCDKN GLTRGPWTPE EDEKLVEFIN KNGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF SPEEQKLVIQ LHGILGNRWA AIASQLPGRT DNEIKNLWNT HLRKRLLSMG  120
IDPQTHEHLS DPNGLVRRPA TSSLARHLAQ WESARLEAEA RLSRESQFLV PSSVGRSETD  180
YFLRIWNSEI GESFRKLKKG EKSACHSPAS QASSCTKYGS ASGITTEVEI GVAGSPVTGS  240
NQNECMEWKI GQPYTEDFLQ GADTCSSNAM DEDSSESALQ LLLDFPSNND MSFLGHSDSY  300
SLYPFLSESY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016538041.10.0PREDICTED: transcription factor MYB51
SwissprotQ9M2D91e-121MYB17_ARATH; Transcription factor MYB17
TrEMBLA0A2G2YXM30.0A0A2G2YXM3_CAPAN; Protein ODORANT1
STRINGPGSC0003DMT4000000940.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-124myb domain protein 17